Class b: All beta proteins [48724] (180 folds) |
Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
Superfamily b.82.3: cAMP-binding domain-like [51206] (4 families) |
Family b.82.3.0: automated matches [227198] (1 protein) not a true family |
Protein automated matches [226927] (20 species) not a true protein |
Species Trypanosoma brucei [TaxId:185431] [372827] (2 PDB entries) |
Domain d6flob2: 6flo B:355-490 [372830] automated match to d4jv4a2 complexed with gol, nos |
PDB Entry: 6flo (more details), 2.14 Å
SCOPe Domain Sequences for d6flob2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6flob2 b.82.3.0 (B:355-490) automated matches {Trypanosoma brucei [TaxId: 185431]} iqfltnipflsgldnyeklqladalssdefepgdyiirygeegewlyiilegsvdvvgrd ddgnekhvwefgkgdhvgeleflnnhanvadvvakthvvtaklnrrhfemclgpvidvlk rtsqqpnyeyyqsklk
Timeline for d6flob2: