SCOPe 2.08: Domain d6floa2: 6flo A:355-489

Lineage for d6floa2 (6flo A:355-489)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.3: cAMP-binding domain-like [51206] (4 families)

5. Family b.82.3.0: automated matches [227198] (1 protein)
   not a true family

6. Protein automated matches [226927] (20 species)
   not a true protein

7. Species Trypanosoma brucei [TaxId:185431] [372827] (2 PDB entries)

8. Domain d6floa2: 6flo A:355-489 [372845]
   automated match to d4jv4a2
   complexed with gol, nos

Details for d6floa2

PDB Entry: 6flo, 2.14 Å

PDB Description: regulatory subunit of a camp-independent protein kinase a from trypanosoma brucei at 2.1 angstrom resolution

PDB Compounds: (A:) Protein kinase A regulatory subunit

SCOPe Domain Sequences for d6floa2:

Sequence, based on SEQRES records:

>d6floa2 b.82.3.0 (A:355-489) automated matches {Trypanosoma brucei [TaxId: 185431]}
iqfltnipflsgldnyeklqladalssdefepgdyiirygeegewlyiilegsvdvvgrd
ddgnekhvwefgkgdhvgeleflnnhanvadvvakthvvtaklnrrhfemclgpvidvlk
rtsqqpnyeyyqskl

Sequence, based on observed residues (ATOM records):

>d6floa2 b.82.3.0 (A:355-489) automated matches {Trypanosoma brucei [TaxId: 185431]}
iqfltnipflsgldnyeklqladalssdefepgdyiirygeegewlyiilegsvdvvgrd
gnekhvwefgkgdhvgeleflnnhanvadvvakthvvtaklnrrhfemclgpvidvlkrt
sqqpnyeyyqskl

Timeline for d6floa2:

• d6floa2 first appeared in SCOPe 2.07