Lineage for d6qqja_ (6qqj A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2970038Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 2970344Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (8 families) (S)
    alpha-beta(2)-alpha(2)-beta(3)
  5. 2970499Family d.110.3.6: Flavin-binding PAS domain [88853] (4 proteins)
    contains PAC motif
  6. 2970518Protein automated matches [190943] (2 species)
    not a true protein
  7. 2970525Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [188509] (20 PDB entries)
  8. 2970547Domain d6qqja_: 6qqj A: [371410]
    automated match to d4eepa_
    complexed with fmn

Details for d6qqja_

PDB Entry: 6qqj (more details), 2.08 Å

PDB Description: room temperature structure of the ground state of atphot2lov2 recorded after an accumulated dose of 354 kgy
PDB Compounds: (A:) Phototropin-2

SCOPe Domain Sequences for d6qqja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6qqja_ d.110.3.6 (A:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
knfvisdprlpdnpiifasdsflelteysreeilgrncrflqgpetdqatvqkirdaird
qreitvqlinytksgkkfwnlfhlqpmrdqkgelqyfigvqldgefip

SCOPe Domain Coordinates for d6qqja_:

Click to download the PDB-style file with coordinates for d6qqja_.
(The format of our PDB-style files is described here.)

Timeline for d6qqja_: