SCOPe 2.08: Domain d1aima_: 1aim A:

Lineage for d1aima_ (1aim A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (24 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.1: Papain-like [54002] (26 proteins)

6. Protein Cruzain [54020] (1 species)

7. Species Trypanosoma cruzi [TaxId:5693] [54021] (29 PDB entries)

8. Domain d1aima_: 1aim A: [37044]
   complexed with zya

Details for d1aima_

PDB Entry: 1aim, 2 Å

PDB Description: cruzain inhibited by benzoyl-tyrosine-alanine-fluoromethylketone

PDB Compounds: (A:) cruzain

SCOPe Domain Sequences for d1aima_:

Sequence; same for both SEQRES and ATOM records:

>d1aima_ d.3.1.1 (A:) Cruzain {Trypanosoma cruzi [TaxId: 5693]}
apaavdwrargavtavkdqgqcgscwafsaignvecqwflaghpltnlseqmlvscdktd
sgcsgglmnnafewivqenngavytedsypyasgegisppcttsghtvgatitghvelpq
deaqiaawlavngpvavavdasswmtytggvmtscvsealdhgvllvgyndsaavpywii
knswttqwgeegyiriakgsnqclvkeeassavvg

Timeline for d1aima_:

• d1aima_ first appeared (with stable ids) in SCOP 1.55, called d1aim__
  
• d1aima_ appears in SCOPe 2.07