Lineage for d1aim__ (1aim -)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.3: Cysteine proteinases [54000] (1 superfamily) Superfamily d.3.1: Cysteine proteinases [54001] (7 families) 
Family d.3.1.1: Papain-like [54002] (15 proteins) 
Protein Cruzain [54020] (1 species) Species Trypanosoma cruzi [TaxId:5693] [54021] (7 PDB entries) 
Domain d1aim__: 1aim - [37044]
Details for d1aim__
PDB Entry: 1aim (more details), 2 Å
PDB Description: cruzain inhibited by benzoyl-tyrosine-alanine-fluoromethylketone
SCOP Domain Sequences for d1aim__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1aim__ d.3.1.1 (-) Cruzain {Trypanosoma cruzi}
apaavdwrargavtavkdqgqcgscwafsaignvecqwflaghpltnlseqmlvscdktd
sgcsgglmnnafewivqenngavytedsypyasgegisppcttsghtvgatitghvelpq
deaqiaawlavngpvavavdasswmtytggvmtscvsealdhgvllvgyndsaavpywii
knswttqwgeegyiriakgsnqclvkeeassavvg
SCOP Domain Coordinates for d1aim__:
Click to download the PDB-style file with coordinates for d1aim__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1aim__:
- d1aim__ appears in SCOP 1.57
- d1aim__ appears in the current release, SCOPe 2.08, called d1aima_
View in 3D