Lineage for d6e56d_ (6e56 D:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2775473Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2775474Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2776220Family b.19.1.0: automated matches [227246] (1 protein)
    not a true family
  6. 2776221Protein automated matches [227017] (58 species)
    not a true protein
  7. 2776624Species Influenza A virus [TaxId:387139] [369088] (2 PDB entries)
  8. 2776626Domain d6e56d_: 6e56 D: [369089]
    Other proteins in same PDB: d6e56i1, d6e56i2, d6e56j1, d6e56j2
    automated match to d3s13a_
    complexed with act, nag

Details for d6e56d_

PDB Entry: 6e56 (more details), 2 Å

PDB Description: human antibody h2214 in complex with influenza hemagglutinin a/aichi/2/1968 (x-31) (h3n2)
PDB Compounds: (D:) Hemagglutinin

SCOPe Domain Sequences for d6e56d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6e56d_ b.19.1.0 (D:) automated matches {Influenza A virus [TaxId: 387139]}
telvqssstgkicnnphrildgidctlidallgdphcdvfqnetwdlfverskafsncyp
ydvpdyaslrslvassgtlefitegftwtgvtqnggsnackrgpgsgffsrlnwltksgs
typvlnvtmpnndnfdklyiwgihhpstdqeqtslyvqasgrvtvstrrsqqtiipnigs
rpwvrglssrisiywtivkpgdvlvinsngnliaprgyfkmrtgkssimrsdapidtcis
ecitpngsipndkpfqnvnkitygacpkyvkqn

SCOPe Domain Coordinates for d6e56d_:

Click to download the PDB-style file with coordinates for d6e56d_.
(The format of our PDB-style files is described here.)

Timeline for d6e56d_: