SCOPe 2.08: Domain d6e56j2: 6e56 J:108-212

Lineage for d6e56j2 (6e56 J:108-212)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)

8. Domain d6e56j2: 6e56 J:108-212 [369074]
   Other proteins in same PDB: d6e56a_, d6e56d_, d6e56i1, d6e56j1
   automated match to d1dn0a2
   complexed with act, nag

Details for d6e56j2

PDB Entry: 6e56, 2 Å

PDB Description: human antibody h2214 in complex with influenza hemagglutinin a/aichi/2/1968 (x-31) (h3n2)

PDB Compounds: (J:) antibody H2214 light chain, K1642

SCOPe Domain Sequences for d6e56j2:

Sequence; same for both SEQRES and ATOM records:

>d6e56j2 b.1.1.2 (J:108-212) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnr

Timeline for d6e56j2:

• d6e56j2 first appeared in SCOPe 2.07