Lineage for d6d5cb1 (6d5c B:15-350)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2829818Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2832343Family c.1.8.0: automated matches [191314] (1 protein)
    not a true family
  6. 2832344Protein automated matches [190075] (132 species)
    not a true protein
  7. 2832509Species Caldicellulosiruptor sp. [TaxId:1387557] [367992] (1 PDB entry)
  8. 2832511Domain d6d5cb1: 6d5c B:15-350 [367994]
    Other proteins in same PDB: d6d5ca2, d6d5cb2, d6d5cc2
    automated match to d5effb_
    complexed with edo, fmt, gol, so4

Details for d6d5cb1

PDB Entry: 6d5c (more details), 1.9 Å

PDB Description: structure of caldicellulosiruptor danielii gh10 module of glycoside hydrolase wp_045175321
PDB Compounds: (B:) glycoside hydrolase WP_045175321

SCOPe Domain Sequences for d6d5cb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6d5cb1 c.1.8.0 (B:15-350) automated matches {Caldicellulosiruptor sp. [TaxId: 1387557]}
apdwsipslcesykddfiigvaiparclsndtdkrmvlkhfnsitaenemkpesllagqt
stglsyrfstadafvdfastnkigirghtlvwhnqtpdwffkdsngqrlskdallarlkq
yiydvvgrykgkvyawdvvneaidenqsdgyrrstwyeicgpeyiekafiwaheadpnak
lfyndynteiskkrefiynmvknlkskgipihgigmqchinvnwpsvseiensiklfssi
pgieihiteldmslynygssenystppqdllqkqaqkykeiftmlkkyknvvksvtfwgl
kddyswlrsfygkndwpllffedysakpaywaviea

SCOPe Domain Coordinates for d6d5cb1:

Click to download the PDB-style file with coordinates for d6d5cb1.
(The format of our PDB-style files is described here.)

Timeline for d6d5cb1: