SCOPe 2.08: Domain d6d5ca1: 6d5c A:15-350

Lineage for d6d5ca1 (6d5c A:15-350)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families)

5. Family c.1.8.0: automated matches [191314] (1 protein)
   not a true family

6. Protein automated matches [190075] (132 species)
   not a true protein

7. Species Caldicellulosiruptor sp. [TaxId:1387557] [367992] (1 PDB entry)

8. Domain d6d5ca1: 6d5c A:15-350 [368136]
   Other proteins in same PDB: d6d5ca2, d6d5cb2, d6d5cc2
   automated match to d5effb_
   complexed with edo, fmt, gol, so4

Details for d6d5ca1

PDB Entry: 6d5c, 1.9 Å

PDB Description: structure of caldicellulosiruptor danielii gh10 module of glycoside hydrolase wp_045175321

PDB Compounds: (A:) glycoside hydrolase WP_045175321

SCOPe Domain Sequences for d6d5ca1:

Sequence; same for both SEQRES and ATOM records:

>d6d5ca1 c.1.8.0 (A:15-350) automated matches {Caldicellulosiruptor sp. [TaxId: 1387557]}
apdwsipslcesykddfiigvaiparclsndtdkrmvlkhfnsitaenemkpesllagqt
stglsyrfstadafvdfastnkigirghtlvwhnqtpdwffkdsngqrlskdallarlkq
yiydvvgrykgkvyawdvvneaidenqsdgyrrstwyeicgpeyiekafiwaheadpnak
lfyndynteiskkrefiynmvknlkskgipihgigmqchinvnwpsvseiensiklfssi
pgieihiteldmslynygssenystppqdllqkqaqkykeiftmlkkyknvvksvtfwgl
kddyswlrsfygkndwpllffedysakpaywaviea

Timeline for d6d5ca1:

• d6d5ca1 first appeared in SCOPe 2.07