Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) |
Family c.1.8.0: automated matches [191314] (1 protein) not a true family |
Protein automated matches [190075] (132 species) not a true protein |
Species Caldicellulosiruptor sp. [TaxId:1387557] [367992] (1 PDB entry) |
Domain d6d5cc1: 6d5c C:15-350 [367993] Other proteins in same PDB: d6d5ca2, d6d5cb2, d6d5cc2 automated match to d5effb_ complexed with edo, fmt, gol, so4 |
PDB Entry: 6d5c (more details), 1.9 Å
SCOPe Domain Sequences for d6d5cc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6d5cc1 c.1.8.0 (C:15-350) automated matches {Caldicellulosiruptor sp. [TaxId: 1387557]} apdwsipslcesykddfiigvaiparclsndtdkrmvlkhfnsitaenemkpesllagqt stglsyrfstadafvdfastnkigirghtlvwhnqtpdwffkdsngqrlskdallarlkq yiydvvgrykgkvyawdvvneaidenqsdgyrrstwyeicgpeyiekafiwaheadpnak lfyndynteiskkrefiynmvknlkskgipihgigmqchinvnwpsvseiensiklfssi pgieihiteldmslynygssenystppqdllqkqaqkykeiftmlkkyknvvksvtfwgl kddyswlrsfygkndwpllffedysakpaywaviea
Timeline for d6d5cc1:
View in 3D Domains from other chains: (mouse over for more information) d6d5ca1, d6d5ca2, d6d5cb1, d6d5cb2 |