Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
Protein automated matches [190069] (319 species) not a true protein |
Species Klebsiella oxytoca [TaxId:571] [364844] (1 PDB entry) |
Domain d6ixjb_: 6ixj B: [364909] automated match to d2nwqb_ complexed with 8x3, ndp |
PDB Entry: 6ixj (more details), 2.8 Å
SCOPe Domain Sequences for d6ixjb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6ixjb_ c.2.1.0 (B:) automated matches {Klebsiella oxytoca [TaxId: 571]} skvvfitgatsgfgeaaaqvfadagwslvlsgrrferlktlqdklasqvpvhiieldvrd sdsvaaavaalpadfadittlinnaglalspqpaqkvdlddwktmidtnvtglvnvthal lptlinhgagasiinigsiagqwpypgshvygaskafvkqfsynlrcdllgtgvrvtdla pgiaeteftlvrtkgdqaasdnlyrgttplsardiaeqmfyiatlpdhmninrvevmpvr qawqpfaidrd
Timeline for d6ixjb_: