Lineage for d6ixjb_ (6ixj B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2845793Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2845794Protein automated matches [190069] (319 species)
    not a true protein
  7. 2847400Species Klebsiella oxytoca [TaxId:571] [364844] (1 PDB entry)
  8. 2847402Domain d6ixjb_: 6ixj B: [364909]
    automated match to d2nwqb_
    complexed with 8x3, ndp

Details for d6ixjb_

PDB Entry: 6ixj (more details), 2.8 Å

PDB Description: the crystal structure of sulfoacetaldehyde reductase from klebsiella oxytoca
PDB Compounds: (B:) Sulfoacetaldehyde reductase

SCOPe Domain Sequences for d6ixjb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ixjb_ c.2.1.0 (B:) automated matches {Klebsiella oxytoca [TaxId: 571]}
skvvfitgatsgfgeaaaqvfadagwslvlsgrrferlktlqdklasqvpvhiieldvrd
sdsvaaavaalpadfadittlinnaglalspqpaqkvdlddwktmidtnvtglvnvthal
lptlinhgagasiinigsiagqwpypgshvygaskafvkqfsynlrcdllgtgvrvtdla
pgiaeteftlvrtkgdqaasdnlyrgttplsardiaeqmfyiatlpdhmninrvevmpvr
qawqpfaidrd

SCOPe Domain Coordinates for d6ixjb_:

Click to download the PDB-style file with coordinates for d6ixjb_.
(The format of our PDB-style files is described here.)

Timeline for d6ixjb_: