PDB entry 6ixj

View 6ixj on RCSB PDB site
Description: The crystal structure of sulfoacetaldehyde reductase from Klebsiella oxytoca
Class: cytosolic protein
Keywords: Sulfoacetaldehyde Reductase, SDR, NADPH, CYTOSOLIC PROTEIN
Deposited on 2018-12-10, released 2019-02-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-02-13, with a file datestamp of 2019-02-08.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Sulfoacetaldehyde reductase
    Species: Klebsiella oxytoca [TaxId:571]
    Gene: isfD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ixja_
  • Chain 'B':
    Compound: Sulfoacetaldehyde reductase
    Species: Klebsiella oxytoca [TaxId:571]
    Gene: isfD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ixjb_
  • Chain 'C':
    Compound: Sulfoacetaldehyde reductase
    Species: Klebsiella oxytoca [TaxId:571]
    Gene: isfD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ixjc_
  • Chain 'D':
    Compound: Sulfoacetaldehyde reductase
    Species: Klebsiella oxytoca [TaxId:571]
    Gene: isfD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ixjd_
  • Chain 'E':
    Compound: Sulfoacetaldehyde reductase
    Species: Klebsiella oxytoca [TaxId:571]
    Gene: isfD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ixje_
  • Chain 'F':
    Compound: Sulfoacetaldehyde reductase
    Species: Klebsiella oxytoca [TaxId:571]
    Gene: isfD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ixjf_
  • Chain 'G':
    Compound: Sulfoacetaldehyde reductase
    Species: Klebsiella oxytoca [TaxId:571]
    Gene: isfD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ixjg_
  • Chain 'H':
    Compound: Sulfoacetaldehyde reductase
    Species: Klebsiella oxytoca [TaxId:571]
    Gene: isfD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ixjh_
  • Chain 'I':
    Compound: Sulfoacetaldehyde reductase
    Species: Klebsiella oxytoca [TaxId:571]
    Gene: isfD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ixji_
  • Chain 'J':
    Compound: Sulfoacetaldehyde reductase
    Species: Klebsiella oxytoca [TaxId:571]
    Gene: isfD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ixjj_
  • Chain 'K':
    Compound: Sulfoacetaldehyde reductase
    Species: Klebsiella oxytoca [TaxId:571]
    Gene: isfD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ixjk_
  • Chain 'L':
    Compound: Sulfoacetaldehyde reductase
    Species: Klebsiella oxytoca [TaxId:571]
    Gene: isfD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ixjl_
  • Heterogens: 8X3, NDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6ixjA (A:)
    snmatskvvfitgatsgfgeaaaqvfadagwslvlsgrrferlktlqdklasqvpvhiie
    ldvrdsdsvaaavaalpadfadittlinnaglalspqpaqkvdlddwktmidtnvtglvn
    vthallptlinhgagasiinigsiagqwpypgshvygaskafvkqfsynlrcdllgtgvr
    vtdlapgiaeteftlvrtkgdqaasdnlyrgttplsardiaeqmfyiatlpdhmninrve
    vmpvrqawqpfaidrd
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ixjA (A:)
    skvvfitgatsgfgeaaaqvfadagwslvlsgrrferlktlqdklasqvpvhiieldvrd
    sdsvaaavaalpadfadittlinnaglalspqpaqkvdlddwktmidtnvtglvnvthal
    lptlinhgagasiinigsiagqwpypgshvygaskafvkqfsynlrcdllgtgvrvtdla
    pgiaeteftlvrtkgdqaasdnlyrgttplsardiaeqmfyiatlpdhmninrvevmpvr
    qawqpfaidrd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6ixjB (B:)
    snmatskvvfitgatsgfgeaaaqvfadagwslvlsgrrferlktlqdklasqvpvhiie
    ldvrdsdsvaaavaalpadfadittlinnaglalspqpaqkvdlddwktmidtnvtglvn
    vthallptlinhgagasiinigsiagqwpypgshvygaskafvkqfsynlrcdllgtgvr
    vtdlapgiaeteftlvrtkgdqaasdnlyrgttplsardiaeqmfyiatlpdhmninrve
    vmpvrqawqpfaidrd
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ixjB (B:)
    skvvfitgatsgfgeaaaqvfadagwslvlsgrrferlktlqdklasqvpvhiieldvrd
    sdsvaaavaalpadfadittlinnaglalspqpaqkvdlddwktmidtnvtglvnvthal
    lptlinhgagasiinigsiagqwpypgshvygaskafvkqfsynlrcdllgtgvrvtdla
    pgiaeteftlvrtkgdqaasdnlyrgttplsardiaeqmfyiatlpdhmninrvevmpvr
    qawqpfaidrd
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6ixjC (C:)
    snmatskvvfitgatsgfgeaaaqvfadagwslvlsgrrferlktlqdklasqvpvhiie
    ldvrdsdsvaaavaalpadfadittlinnaglalspqpaqkvdlddwktmidtnvtglvn
    vthallptlinhgagasiinigsiagqwpypgshvygaskafvkqfsynlrcdllgtgvr
    vtdlapgiaeteftlvrtkgdqaasdnlyrgttplsardiaeqmfyiatlpdhmninrve
    vmpvrqawqpfaidrd
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ixjC (C:)
    skvvfitgatsgfgeaaaqvfadagwslvlsgrrferlktlqdklasqvpvhiieldvrd
    sdsvaaavaalpadfadittlinnaglalspqpaqkvdlddwktmidtnvtglvnvthal
    lptlinhgagasiinigsiagqwpypgshvygaskafvkqfsynlrcdllgtgvrvtdla
    pgiaeteftlvrtkgdqaasdnlyrgttplsardiaeqmfyiatlpdhmninrvevmpvr
    qawqpfaidr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6ixjD (D:)
    snmatskvvfitgatsgfgeaaaqvfadagwslvlsgrrferlktlqdklasqvpvhiie
    ldvrdsdsvaaavaalpadfadittlinnaglalspqpaqkvdlddwktmidtnvtglvn
    vthallptlinhgagasiinigsiagqwpypgshvygaskafvkqfsynlrcdllgtgvr
    vtdlapgiaeteftlvrtkgdqaasdnlyrgttplsardiaeqmfyiatlpdhmninrve
    vmpvrqawqpfaidrd
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ixjD (D:)
    skvvfitgatsgfgeaaaqvfadagwslvlsgrrferlktlqdklasqvpvhiieldvrd
    sdsvaaavaalpadfadittlinnaglalspqpaqkvdlddwktmidtnvtglvnvthal
    lptlinhgagasiinigsiagqwpypgshvygaskafvkqfsynlrcdllgtgvrvtdla
    pgiaeteftlvrtkgdqaasdnlyrgttplsardiaeqmfyiatlpdhmninrvevmpvr
    qawqpfaidrd
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >6ixjE (E:)
    snmatskvvfitgatsgfgeaaaqvfadagwslvlsgrrferlktlqdklasqvpvhiie
    ldvrdsdsvaaavaalpadfadittlinnaglalspqpaqkvdlddwktmidtnvtglvn
    vthallptlinhgagasiinigsiagqwpypgshvygaskafvkqfsynlrcdllgtgvr
    vtdlapgiaeteftlvrtkgdqaasdnlyrgttplsardiaeqmfyiatlpdhmninrve
    vmpvrqawqpfaidrd
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ixjE (E:)
    skvvfitgatsgfgeaaaqvfadagwslvlsgrrferlktlqdklasqvpvhiieldvrd
    sdsvaaavaalpadfadittlinnaglalspqpaqkvdlddwktmidtnvtglvnvthal
    lptlinhgagasiinigsiagqwpypgshvygaskafvkqfsynlrcdllgtgvrvtdla
    pgiaeteftlvrtkgdqaasdnlyrgttplsardiaeqmfyiatlpdhmninrvevmpvr
    qawqpfaidrd
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >6ixjF (F:)
    snmatskvvfitgatsgfgeaaaqvfadagwslvlsgrrferlktlqdklasqvpvhiie
    ldvrdsdsvaaavaalpadfadittlinnaglalspqpaqkvdlddwktmidtnvtglvn
    vthallptlinhgagasiinigsiagqwpypgshvygaskafvkqfsynlrcdllgtgvr
    vtdlapgiaeteftlvrtkgdqaasdnlyrgttplsardiaeqmfyiatlpdhmninrve
    vmpvrqawqpfaidrd
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ixjF (F:)
    skvvfitgatsgfgeaaaqvfadagwslvlsgrrferlktlqdklasqvpvhiieldvrd
    sdsvaaavaalpadfadittlinnaglalspqpaqkvdlddwktmidtnvtglvnvthal
    lptlinhgagasiinigsiagqwpypgshvygaskafvkqfsynlrcdllgtgvrvtdla
    pgiaeteftlvrtkgdqaasdnlyrgttplsardiaeqmfyiatlpdhmninrvevmpvr
    qawqpfaidrd
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >6ixjG (G:)
    snmatskvvfitgatsgfgeaaaqvfadagwslvlsgrrferlktlqdklasqvpvhiie
    ldvrdsdsvaaavaalpadfadittlinnaglalspqpaqkvdlddwktmidtnvtglvn
    vthallptlinhgagasiinigsiagqwpypgshvygaskafvkqfsynlrcdllgtgvr
    vtdlapgiaeteftlvrtkgdqaasdnlyrgttplsardiaeqmfyiatlpdhmninrve
    vmpvrqawqpfaidrd
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ixjG (G:)
    skvvfitgatsgfgeaaaqvfadagwslvlsgrrferlktlqdklasqvpvhiieldvrd
    sdsvaaavaalpadfadittlinnaglalspqpaqkvdlddwktmidtnvtglvnvthal
    lptlinhgagasiinigsiagqwpypgshvygaskafvkqfsynlrcdllgtgvrvtdla
    pgiaeteftlvrtkgdqaasdnlyrgttplsardiaeqmfyiatlpdhmninrvevmpvr
    qawqpfaidrd
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >6ixjH (H:)
    snmatskvvfitgatsgfgeaaaqvfadagwslvlsgrrferlktlqdklasqvpvhiie
    ldvrdsdsvaaavaalpadfadittlinnaglalspqpaqkvdlddwktmidtnvtglvn
    vthallptlinhgagasiinigsiagqwpypgshvygaskafvkqfsynlrcdllgtgvr
    vtdlapgiaeteftlvrtkgdqaasdnlyrgttplsardiaeqmfyiatlpdhmninrve
    vmpvrqawqpfaidrd
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ixjH (H:)
    skvvfitgatsgfgeaaaqvfadagwslvlsgrrferlktlqdklasqvpvhiieldvrd
    sdsvaaavaalpadfadittlinnaglalspqpaqkvdlddwktmidtnvtglvnvthal
    lptlinhgagasiinigsiagqwpypgshvygaskafvkqfsynlrcdllgtgvrvtdla
    pgiaeteftlvrtkgdqaasdnlyrgttplsardiaeqmfyiatlpdhmninrvevmpvr
    qawqpfaidrd
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >6ixjI (I:)
    snmatskvvfitgatsgfgeaaaqvfadagwslvlsgrrferlktlqdklasqvpvhiie
    ldvrdsdsvaaavaalpadfadittlinnaglalspqpaqkvdlddwktmidtnvtglvn
    vthallptlinhgagasiinigsiagqwpypgshvygaskafvkqfsynlrcdllgtgvr
    vtdlapgiaeteftlvrtkgdqaasdnlyrgttplsardiaeqmfyiatlpdhmninrve
    vmpvrqawqpfaidrd
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ixjI (I:)
    skvvfitgatsgfgeaaaqvfadagwslvlsgrrferlktlqdklasqvpvhiieldvrd
    sdsvaaavaalpadfadittlinnaglalspqpaqkvdlddwktmidtnvtglvnvthal
    lptlinhgagasiinigsiagqwpypgshvygaskafvkqfsynlrcdllgtgvrvtdla
    pgiaeteftlvrtkgdqaasdnlyrgttplsardiaeqmfyiatlpdhmninrvevmpvr
    qawqpfaidrd
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >6ixjJ (J:)
    snmatskvvfitgatsgfgeaaaqvfadagwslvlsgrrferlktlqdklasqvpvhiie
    ldvrdsdsvaaavaalpadfadittlinnaglalspqpaqkvdlddwktmidtnvtglvn
    vthallptlinhgagasiinigsiagqwpypgshvygaskafvkqfsynlrcdllgtgvr
    vtdlapgiaeteftlvrtkgdqaasdnlyrgttplsardiaeqmfyiatlpdhmninrve
    vmpvrqawqpfaidrd
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ixjJ (J:)
    skvvfitgatsgfgeaaaqvfadagwslvlsgrrferlktlqdklasqvpvhiieldvrd
    sdsvaaavaalpadfadittlinnaglalspqpaqkvdlddwktmidtnvtglvnvthal
    lptlinhgagasiinigsiagqwpypgshvygaskafvkqfsynlrcdllgtgvrvtdla
    pgiaeteftlvrtkgdqaasdnlyrgttplsardiaeqmfyiatlpdhmninrvevmpvr
    qawqpfaidrd
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >6ixjK (K:)
    snmatskvvfitgatsgfgeaaaqvfadagwslvlsgrrferlktlqdklasqvpvhiie
    ldvrdsdsvaaavaalpadfadittlinnaglalspqpaqkvdlddwktmidtnvtglvn
    vthallptlinhgagasiinigsiagqwpypgshvygaskafvkqfsynlrcdllgtgvr
    vtdlapgiaeteftlvrtkgdqaasdnlyrgttplsardiaeqmfyiatlpdhmninrve
    vmpvrqawqpfaidrd
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ixjK (K:)
    skvvfitgatsgfgeaaaqvfadagwslvlsgrrferlktlqdklasqvpvhiieldvrd
    sdsvaaavaalpadfadittlinnaglalspqpaqkvdlddwktmidtnvtglvnvthal
    lptlinhgagasiinigsiagqwpypgshvygaskafvkqfsynlrcdllgtgvrvtdla
    pgiaeteftlvrtkgdqaasdnlyrgttplsardiaeqmfyiatlpdhmninrvevmpvr
    qawqpfaidrd
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >6ixjL (L:)
    snmatskvvfitgatsgfgeaaaqvfadagwslvlsgrrferlktlqdklasqvpvhiie
    ldvrdsdsvaaavaalpadfadittlinnaglalspqpaqkvdlddwktmidtnvtglvn
    vthallptlinhgagasiinigsiagqwpypgshvygaskafvkqfsynlrcdllgtgvr
    vtdlapgiaeteftlvrtkgdqaasdnlyrgttplsardiaeqmfyiatlpdhmninrve
    vmpvrqawqpfaidrd
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ixjL (L:)
    skvvfitgatsgfgeaaaqvfadagwslvlsgrrferlktlqdklasqvpvhiieldvrd
    sdsvaaavaalpadfadittlinnaglalspqpaqkvdlddwktmidtnvtglvnvthal
    lptlinhgagasiinigsiagqwpypgshvygaskafvkqfsynlrcdllgtgvrvtdla
    pgiaeteftlvrtkgdqaasdnlyrgttplsardiaeqmfyiatlpdhmninrvevmpvr
    qawqpfaidrd