Lineage for d6ixjd_ (6ixj D:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2426096Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2426097Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2430344Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2430345Protein automated matches [190069] (259 species)
    not a true protein
  7. 3064782Species Klebsiella oxytoca [TaxId:571] [364844] (1 PDB entry)
  8. 3064808Domain d6ixjd_: 6ixj D: [364870]
    automated match to d2nwqb_
    complexed with 8x3, ndp

Details for d6ixjd_

PDB Entry: 6ixj (more details), 2.8 Å

PDB Description: the crystal structure of sulfoacetaldehyde reductase from klebsiella oxytoca
PDB Compounds: (D:) Sulfoacetaldehyde reductase

SCOPe Domain Sequences for d6ixjd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ixjd_ c.2.1.0 (D:) automated matches {Klebsiella oxytoca [TaxId: 571]}
skvvfitgatsgfgeaaaqvfadagwslvlsgrrferlktlqdklasqvpvhiieldvrd
sdsvaaavaalpadfadittlinnaglalspqpaqkvdlddwktmidtnvtglvnvthal
lptlinhgagasiinigsiagqwpypgshvygaskafvkqfsynlrcdllgtgvrvtdla
pgiaeteftlvrtkgdqaasdnlyrgttplsardiaeqmfyiatlpdhmninrvevmpvr
qawqpfaidrd

SCOPe Domain Coordinates for d6ixjd_:

Click to download the PDB-style file with coordinates for d6ixjd_.
(The format of our PDB-style files is described here.)

Timeline for d6ixjd_:

  • d6ixjd_ appears in periodic updates to SCOPe 2.07 starting on 2019-02-14