Lineage for d6n4db_ (6n4d B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2807606Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 2807607Superfamily b.68.1: Sialidases [50939] (3 families) (S)
  5. 2807608Family b.68.1.1: Sialidases (neuraminidases) [50940] (10 proteins)
  6. 2807958Protein automated matches [193245] (21 species)
    not a true protein
  7. 2808101Species Unidentified influenza virus [TaxId:11309] [364248] (1 PDB entry)
  8. 2808103Domain d6n4db_: 6n4d B: [364250]
    automated match to d2bata_
    complexed with ca, nag

Details for d6n4db_

PDB Entry: 6n4d (more details), 1.8 Å

PDB Description: the crystal structure of neuramindase from a/canine/il/11613/2015 (h3n2) influenza virus.
PDB Compounds: (B:) Neuraminidase

SCOPe Domain Sequences for d6n4db_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6n4db_ b.68.1.1 (B:) automated matches {Unidentified influenza virus [TaxId: 11309]}
leyrnwskpqcqitgfapfskdnsirlsaggdiwvtrepyvscdhskcyqfalgqgttln
nkhsnstihdrtshrtllmnelgvpfhlgtkqvciawsssschdgkawlhvcvtgddrna
tasfvyngmlvdsigswsrnilrtqesecvcingtctvvmtdgsasgradtrilfiregk
iihisplsgsaqhieecscyprypnvrcvcrdnwkgsnrpvidinmadyninssyvcsgl
vgdtprnddsssssnckdpnnergnpgvkgwafdndndvwmgrtiskdlrsgyetfkvig
gwttansksqvnrqvivdnnnwsgysgifsvegkscvnrcfyvelirggpqetrvwwtsn
sivvfcgtsgtygtgswpdganinfmpi

SCOPe Domain Coordinates for d6n4db_:

Click to download the PDB-style file with coordinates for d6n4db_.
(The format of our PDB-style files is described here.)

Timeline for d6n4db_: