PDB entry 6n4d

View 6n4d on RCSB PDB site
Description: The crystal structure of neuramindase from A/canine/IL/11613/2015 (H3N2) influenza virus.
Class: viral protein
Keywords: Neuraminidase, canine influenza virus, VIRAL PROTEIN
Deposited on 2018-11-19, released 2019-01-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-01-30, with a file datestamp of 2019-01-25.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Neuraminidase
    Species: unidentified influenza virus [TaxId:11309]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6n4da_
  • Chain 'B':
    Compound: Neuraminidase
    Species: unidentified influenza virus [TaxId:11309]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6n4db_
  • Chain 'C':
    Compound: Neuraminidase
    Species: unidentified influenza virus [TaxId:11309]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6n4dc_
  • Chain 'D':
    Compound: Neuraminidase
    Species: unidentified influenza virus [TaxId:11309]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6n4dd_
  • Heterogens: CA, NAG, BMA, MAN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6n4dA (A:)
    gsgdsgspgleyrnwskpqcqitgfapfskdnsirlsaggdiwvtrepyvscdhskcyqf
    algqgttlnnkhsnstihdrtshrtllmnelgvpfhlgtkqvciawsssschdgkawlhv
    cvtgddrnatasfvyngmlvdsigswsrnilrtqesecvcingtctvvmtdgsasgradt
    rilfiregkiihisplsgsaqhieecscyprypnvrcvcrdnwkgsnrpvidinmadyni
    nssyvcsglvgdtprnddsssssnckdpnnergnpgvkgwafdndndvwmgrtiskdlrs
    gyetfkviggwttansksqvnrqvivdnnnwsgysgifsvegkscvnrcfyvelirggpq
    etrvwwtsnsivvfcgtsgtygtgswpdganinfmpi
    

    Sequence, based on observed residues (ATOM records): (download)
    >6n4dA (A:)
    leyrnwskpqcqitgfapfskdnsirlsaggdiwvtrepyvscdhskcyqfalgqgttln
    nkhsnstihdrtshrtllmnelgvpfhlgtkqvciawsssschdgkawlhvcvtgddrna
    tasfvyngmlvdsigswsrnilrtqesecvcingtctvvmtdgsasgradtrilfiregk
    iihisplsgsaqhieecscyprypnvrcvcrdnwkgsnrpvidinmadyninssyvcsgl
    vgdtprnddsssssnckdpnnergnpgvkgwafdndndvwmgrtiskdlrsgyetfkvig
    gwttansksqvnrqvivdnnnwsgysgifsvegkscvnrcfyvelirggpqetrvwwtsn
    sivvfcgtsgtygtgswpdganinfmpi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6n4dB (B:)
    gsgdsgspgleyrnwskpqcqitgfapfskdnsirlsaggdiwvtrepyvscdhskcyqf
    algqgttlnnkhsnstihdrtshrtllmnelgvpfhlgtkqvciawsssschdgkawlhv
    cvtgddrnatasfvyngmlvdsigswsrnilrtqesecvcingtctvvmtdgsasgradt
    rilfiregkiihisplsgsaqhieecscyprypnvrcvcrdnwkgsnrpvidinmadyni
    nssyvcsglvgdtprnddsssssnckdpnnergnpgvkgwafdndndvwmgrtiskdlrs
    gyetfkviggwttansksqvnrqvivdnnnwsgysgifsvegkscvnrcfyvelirggpq
    etrvwwtsnsivvfcgtsgtygtgswpdganinfmpi
    

    Sequence, based on observed residues (ATOM records): (download)
    >6n4dB (B:)
    leyrnwskpqcqitgfapfskdnsirlsaggdiwvtrepyvscdhskcyqfalgqgttln
    nkhsnstihdrtshrtllmnelgvpfhlgtkqvciawsssschdgkawlhvcvtgddrna
    tasfvyngmlvdsigswsrnilrtqesecvcingtctvvmtdgsasgradtrilfiregk
    iihisplsgsaqhieecscyprypnvrcvcrdnwkgsnrpvidinmadyninssyvcsgl
    vgdtprnddsssssnckdpnnergnpgvkgwafdndndvwmgrtiskdlrsgyetfkvig
    gwttansksqvnrqvivdnnnwsgysgifsvegkscvnrcfyvelirggpqetrvwwtsn
    sivvfcgtsgtygtgswpdganinfmpi
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6n4dC (C:)
    gsgdsgspgleyrnwskpqcqitgfapfskdnsirlsaggdiwvtrepyvscdhskcyqf
    algqgttlnnkhsnstihdrtshrtllmnelgvpfhlgtkqvciawsssschdgkawlhv
    cvtgddrnatasfvyngmlvdsigswsrnilrtqesecvcingtctvvmtdgsasgradt
    rilfiregkiihisplsgsaqhieecscyprypnvrcvcrdnwkgsnrpvidinmadyni
    nssyvcsglvgdtprnddsssssnckdpnnergnpgvkgwafdndndvwmgrtiskdlrs
    gyetfkviggwttansksqvnrqvivdnnnwsgysgifsvegkscvnrcfyvelirggpq
    etrvwwtsnsivvfcgtsgtygtgswpdganinfmpi
    

    Sequence, based on observed residues (ATOM records): (download)
    >6n4dC (C:)
    leyrnwskpqcqitgfapfskdnsirlsaggdiwvtrepyvscdhskcyqfalgqgttln
    nkhsnstihdrtshrtllmnelgvpfhlgtkqvciawsssschdgkawlhvcvtgddrna
    tasfvyngmlvdsigswsrnilrtqesecvcingtctvvmtdgsasgradtrilfiregk
    iihisplsgsaqhieecscyprypnvrcvcrdnwkgsnrpvidinmadyninssyvcsgl
    vgdtprnddsssssnckdpnnergnpgvkgwafdndndvwmgrtiskdlrsgyetfkvig
    gwttansksqvnrqvivdnnnwsgysgifsvegkscvnrcfyvelirggpqetrvwwtsn
    sivvfcgtsgtygtgswpdganinfmpi
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6n4dD (D:)
    gsgdsgspgleyrnwskpqcqitgfapfskdnsirlsaggdiwvtrepyvscdhskcyqf
    algqgttlnnkhsnstihdrtshrtllmnelgvpfhlgtkqvciawsssschdgkawlhv
    cvtgddrnatasfvyngmlvdsigswsrnilrtqesecvcingtctvvmtdgsasgradt
    rilfiregkiihisplsgsaqhieecscyprypnvrcvcrdnwkgsnrpvidinmadyni
    nssyvcsglvgdtprnddsssssnckdpnnergnpgvkgwafdndndvwmgrtiskdlrs
    gyetfkviggwttansksqvnrqvivdnnnwsgysgifsvegkscvnrcfyvelirggpq
    etrvwwtsnsivvfcgtsgtygtgswpdganinfmpi
    

    Sequence, based on observed residues (ATOM records): (download)
    >6n4dD (D:)
    leyrnwskpqcqitgfapfskdnsirlsaggdiwvtrepyvscdhskcyqfalgqgttln
    nkhsnstihdrtshrtllmnelgvpfhlgtkqvciawsssschdgkawlhvcvtgddrna
    tasfvyngmlvdsigswsrnilrtqesecvcingtctvvmtdgsasgradtrilfiregk
    iihisplsgsaqhieecscyprypnvrcvcrdnwkgsnrpvidinmadyninssyvcsgl
    vgdtprnddsssssnckdpnnergnpgvkgwafdndndvwmgrtiskdlrsgyetfkvig
    gwttansksqvnrqvivdnnnwsgysgifsvegkscvnrcfyvelirggpqetrvwwtsn
    sivvfcgtsgtygtgswpdganinfmpi