Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds) |
Fold e.17: D-aminoacid aminotransferase-like PLP-dependent enzymes [56751] (1 superfamily) 2 domains: (1) alpha+beta: beta3-alpha2-beta2; (2) alpha/beta, a part of its mixed sheet forms barrel: n=6, S=8 |
Superfamily e.17.1: D-aminoacid aminotransferase-like PLP-dependent enzymes [56752] (2 families) |
Family e.17.1.0: automated matches [191499] (1 protein) not a true family |
Protein automated matches [190815] (21 species) not a true protein |
Species Thermobaculum terrenum [TaxId:525904] [358010] (4 PDB entries) |
Domain d6q8ea_: 6q8e A: [361985] automated match to d3u0ga_ complexed with cl, pmp |
PDB Entry: 6q8e (more details), 1.5 Å
SCOPe Domain Sequences for d6q8ea_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6q8ea_ e.17.1.0 (A:) automated matches {Thermobaculum terrenum [TaxId: 525904]} enpkylwwnhriipweeatvhltdywwasvtavfegirgywnnaegemyifrledharrl eqsmqlirmpkeftvdeicqatidlvrandyrgdvyimplayavgnkafsvvgdrttemf iysrpavsrleedfslhacysswtrinervlpprikalanyrnsqlasseaamngydtal flnpegkvaegtgscvffvrkgklitpditsgilesitrdtvihlarevlgleveervvd rtetyladeaflcgthaeitpiasidrhemkhgapgpitrqlrdiyrevvygrdfryrnw ltpvgmg
Timeline for d6q8ea_: