Lineage for d6q8ea_ (6q8e A:)

  1. Root: SCOPe 2.08
  2. 3012399Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. 3018494Fold e.17: D-aminoacid aminotransferase-like PLP-dependent enzymes [56751] (1 superfamily)
    2 domains: (1) alpha+beta: beta3-alpha2-beta2; (2) alpha/beta, a part of its mixed sheet forms barrel: n=6, S=8
  4. 3018495Superfamily e.17.1: D-aminoacid aminotransferase-like PLP-dependent enzymes [56752] (2 families) (S)
  5. 3018614Family e.17.1.0: automated matches [191499] (1 protein)
    not a true family
  6. 3018615Protein automated matches [190815] (21 species)
    not a true protein
  7. 3018701Species Thermobaculum terrenum [TaxId:525904] [358010] (4 PDB entries)
  8. 3018702Domain d6q8ea_: 6q8e A: [361985]
    automated match to d3u0ga_
    complexed with cl, pmp

Details for d6q8ea_

PDB Entry: 6q8e (more details), 1.5 Å

PDB Description: crystal structure of branched-chain amino acid aminotransferase from thermobaculum terrenum in pmp-form
PDB Compounds: (A:) branched-chain-amino-acid aminotransferase

SCOPe Domain Sequences for d6q8ea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6q8ea_ e.17.1.0 (A:) automated matches {Thermobaculum terrenum [TaxId: 525904]}
enpkylwwnhriipweeatvhltdywwasvtavfegirgywnnaegemyifrledharrl
eqsmqlirmpkeftvdeicqatidlvrandyrgdvyimplayavgnkafsvvgdrttemf
iysrpavsrleedfslhacysswtrinervlpprikalanyrnsqlasseaamngydtal
flnpegkvaegtgscvffvrkgklitpditsgilesitrdtvihlarevlgleveervvd
rtetyladeaflcgthaeitpiasidrhemkhgapgpitrqlrdiyrevvygrdfryrnw
ltpvgmg

SCOPe Domain Coordinates for d6q8ea_:

Click to download the PDB-style file with coordinates for d6q8ea_.
(The format of our PDB-style files is described here.)

Timeline for d6q8ea_: