PDB entry 6q8e

View 6q8e on RCSB PDB site
Description: Crystal structure of branched-chain amino acid aminotransferase from Thermobaculum terrenum in PMP-form
Class: transferase
Keywords: branched-chain, aminotransferase, PLP, PMP, transaminase, thermophlic, dimer, TRANSFERASE
Deposited on 2018-12-14, released 2019-01-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-01-02, with a file datestamp of 2018-12-28.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: branched-chain-amino-acid aminotransferase
    Species: Thermobaculum terrenum (strain ATCC BAA-798 / YNP1) [TaxId:525904]
    Gene: ilvE, Tter_1720
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6q8ea_
  • Heterogens: PMP, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6q8eA (A:)
    msqqenpkylwwnhriipweeatvhltdywwasvtavfegirgywnnaegemyifrledh
    arrleqsmqlirmpkeftvdeicqatidlvrandyrgdvyimplayavgnkafsvvgdrt
    temfiysrpavsrleedfslhacysswtrinervlpprikalanyrnsqlasseaamngy
    dtalflnpegkvaegtgscvffvrkgklitpditsgilesitrdtvihlarevlglevee
    rvvdrtetyladeaflcgthaeitpiasidrhemkhgapgpitrqlrdiyrevvygrdfr
    yrnwltpvgmgvraeq
    

    Sequence, based on observed residues (ATOM records): (download)
    >6q8eA (A:)
    enpkylwwnhriipweeatvhltdywwasvtavfegirgywnnaegemyifrledharrl
    eqsmqlirmpkeftvdeicqatidlvrandyrgdvyimplayavgnkafsvvgdrttemf
    iysrpavsrleedfslhacysswtrinervlpprikalanyrnsqlasseaamngydtal
    flnpegkvaegtgscvffvrkgklitpditsgilesitrdtvihlarevlgleveervvd
    rtetyladeaflcgthaeitpiasidrhemkhgapgpitrqlrdiyrevvygrdfryrnw
    ltpvgmg