Lineage for d6dmga_ (6dmg A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2979545Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2979546Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2979693Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2981976Protein MAP kinase Erk2 [56134] (2 species)
    CMGC group; ERK/MAPK subfamily; serine/threonine kinase
  7. 2981977Species Human (Homo sapiens) [TaxId:9606] [56135] (74 PDB entries)
  8. 2982034Domain d6dmga_: 6dmg A: [361448]
    automated match to d4zxta_
    complexed with edo, ek6, so4

Details for d6dmga_

PDB Entry: 6dmg (more details), 2.2 Å

PDB Description: a multiconformer ligand model of ek6 bound to erk2
PDB Compounds: (A:) Mitogen-activated protein kinase 1

SCOPe Domain Sequences for d6dmga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6dmga_ d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606]}
pemvrgqvfdvgprytnlsyigegaygmvcsaydnvnkvrvaikkispfehqtycqrtlr
eikillrfrheniigindiiraptieqmkdvyivqdlmetdlykllktqhlsndhicyfl
yqilrglkyihsanvlhrdlkpsnlllnttcdlkicdfglarvadpdhdhtgflteyvat
rwyrapeimlnskgytksidiwsvgcilaemlsnrpifpgkhyldqlnhilgilgspsqe
dlnciinlkarnyllslphknkvpwnrlfpnadskaldlldkmltfnphkrieveqalah
pyleqyydpsdepiaeapfkfdmelddlpkeklkelifeetarfqpg

SCOPe Domain Coordinates for d6dmga_:

Click to download the PDB-style file with coordinates for d6dmga_.
(The format of our PDB-style files is described here.)

Timeline for d6dmga_: