SCOPe 2.07: Domain d6h7aa1: 6h7a A:482-560

Lineage for d6h7aa1 (6h7a A:482-560)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.144: PABP domain-like [63569] (2 superfamilies)
   4 helices; an orthogonal array

4. Superfamily a.144.1: PABC (PABP) domain [63570] (2 families)

5. Family a.144.1.0: automated matches [254226] (1 protein)
   not a true family

6. Protein automated matches [254511] (2 species)
   not a true protein

7. Species Leishmania major [TaxId:5664] [361100] (1 PDB entry)

8. Domain d6h7aa1: 6h7a A:482-560 [361101]
   Other proteins in same PDB: d6h7aa2
   automated match to d2rqhb_

Details for d6h7aa1

PDB Entry: 6h7a, 2.03 Å

PDB Description: structure of leishmania pabp1 (domain j).

PDB Compounds: (A:) PABP1 domain J

SCOPe Domain Sequences for d6h7aa1:

Sequence; same for both SEQRES and ATOM records:

>d6h7aa1 a.144.1.0 (A:482-560) automated matches {Leishmania major [TaxId: 5664]}
lppitpqelesmspqeqraalgdrlflkvyeiapelapkitgmflemkpkeayellndqk
rleervtealcvlkahqta

Timeline for d6h7aa1:

• d6h7aa1 is new in SCOPe 2.07-stable
  
• d6h7aa1 appears in the current release, SCOPe 2.08