Class a: All alpha proteins [46456] (289 folds) |
Fold a.144: PABP domain-like [63569] (2 superfamilies) 4 helices; an orthogonal array |
Superfamily a.144.1: PABC (PABP) domain [63570] (2 families) |
Family a.144.1.0: automated matches [254226] (1 protein) not a true family |
Protein automated matches [254511] (2 species) not a true protein |
Species Leishmania major [TaxId:5664] [361100] (1 PDB entry) |
Domain d6h7ab_: 6h7a B: [361108] Other proteins in same PDB: d6h7aa2 automated match to d2rqhb_ |
PDB Entry: 6h7a (more details), 2.03 Å
SCOPe Domain Sequences for d6h7ab_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6h7ab_ a.144.1.0 (B:) automated matches {Leishmania major [TaxId: 5664]} lppitpqelesmspqeqraalgdrlflkvyeiapelapkitgmflemkpkeayellndqk rleervtealcvlkahqta
Timeline for d6h7ab_: