Lineage for d2rqhb_ (2rqh B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2347885Fold a.144: PABP domain-like [63569] (2 superfamilies)
    4 helices; an orthogonal array
  4. 2347886Superfamily a.144.1: PABC (PABP) domain [63570] (2 families) (S)
  5. 2347887Family a.144.1.1: PABC (PABP) domain [63571] (3 proteins)
  6. 2347900Protein automated matches [191271] (2 species)
    not a true protein
  7. 2347901Species Human (Homo sapiens) [TaxId:9606] [226585] (4 PDB entries)
  8. 2347914Domain d2rqhb_: 2rqh B: [243751]
    automated match to d4iveb_
    protein/RNA complex

Details for d2rqhb_

PDB Entry: 2rqh (more details)

PDB Description: structure of gspt1/erf3a-pabc
PDB Compounds: (B:) polyadenylate-binding protein 1

SCOPe Domain Sequences for d2rqhb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2rqhb_ a.144.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gqepltasmlasappqeqkqmlgerlfpliqamhptlagkitgmlleidnsellhmlesp
eslrskvdeavavlqahqakeaa

SCOPe Domain Coordinates for d2rqhb_:

Click to download the PDB-style file with coordinates for d2rqhb_.
(The format of our PDB-style files is described here.)

Timeline for d2rqhb_: