Lineage for d6h7aa1 (6h7a A:482-560)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2340459Fold a.144: PABP domain-like [63569] (2 superfamilies)
    4 helices; an orthogonal array
  4. 2340460Superfamily a.144.1: PABC (PABP) domain [63570] (2 families) (S)
  5. 2340493Family a.144.1.0: automated matches [254226] (1 protein)
    not a true family
  6. 2340494Protein automated matches [254511] (2 species)
    not a true protein
  7. 3061038Species Leishmania major [TaxId:5664] [361100] (1 PDB entry)
  8. 3061039Domain d6h7aa1: 6h7a A:482-560 [361101]
    Other proteins in same PDB: d6h7aa2
    automated match to d2rqhb_

Details for d6h7aa1

PDB Entry: 6h7a (more details), 2.03 Å

PDB Description: structure of leishmania pabp1 (domain j).
PDB Compounds: (A:) PABP1 domain J

SCOPe Domain Sequences for d6h7aa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6h7aa1 a.144.1.0 (A:482-560) automated matches {Leishmania major [TaxId: 5664]}
lppitpqelesmspqeqraalgdrlflkvyeiapelapkitgmflemkpkeayellndqk
rleervtealcvlkahqta

SCOPe Domain Coordinates for d6h7aa1:

Click to download the PDB-style file with coordinates for d6h7aa1.
(The format of our PDB-style files is described here.)

Timeline for d6h7aa1:

  • d6h7aa1 appears in periodic updates to SCOPe 2.07 starting on 2018-12-13

View in 3D
Domains from same chain:
(mouse over for more information)
d6h7aa2
View in 3D
Domains from other chains:
(mouse over for more information)
d6h7ab_