Lineage for d6if1a1 (6if1 A:1-156)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2507728Fold d.20: UBC-like [54494] (1 superfamily)
    alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
  4. 2507729Superfamily d.20.1: UBC-like [54495] (5 families) (S)
  5. 2507730Family d.20.1.1: UBC-related [54496] (7 proteins)
  6. 2507938Protein Ubiquitin-conjugating enzyme E2-25 kDa, E2 domain [143063] (2 species)
    ubc1 homologue; also contains the C-terminal UBA domain
  7. 2507941Species Human (Homo sapiens) [TaxId:9606] [143064] (8 PDB entries)
    Uniprot P61086 1-156
  8. 3060426Domain d6if1a1: 6if1 A:1-156 [360488]
    Other proteins in same PDB: d6if1a2, d6if1b2, d6if1c_, d6if1d_
    automated match to d3e46a2

Details for d6if1a1

PDB Entry: 6if1 (more details), 2.47 Å

PDB Description: crystal structure of ube2k and k48-linked di-ubiquitin complex
PDB Compounds: (A:) Ubiquitin-conjugating enzyme E2 K

SCOPe Domain Sequences for d6if1a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6if1a1 d.20.1.1 (A:1-156) Ubiquitin-conjugating enzyme E2-25 kDa, E2 domain {Human (Homo sapiens) [TaxId: 9606]}
maniavqrikrefkevlkseetsknqikvdlvdenftelrgeiagppdtpyeggryqlei
kipetypfnppkvrfitkiwhpnissvtgaicldilkdqwaaamtlrtvllslqallaaa
epddpqdavvanqykqnpemfkqtarlwahvyagap

SCOPe Domain Coordinates for d6if1a1:

Click to download the PDB-style file with coordinates for d6if1a1.
(The format of our PDB-style files is described here.)

Timeline for d6if1a1:

  • d6if1a1 appears in periodic updates to SCOPe 2.07 starting on 2018-11-22