Lineage for d6if1a2 (6if1 A:157-199)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2308343Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies)
    3 helices; bundle, right-handed twist
  4. 2308367Superfamily a.5.2: UBA-like [46934] (5 families) (S)
  5. 2308368Family a.5.2.1: UBA domain [46935] (25 proteins)
  6. 2308450Protein Ubiquitin-conjugating enzyme E2-25 kDa, C-terminal domain [140327] (1 species)
  7. 2308451Species Human (Homo sapiens) [TaxId:9606] [140328] (10 PDB entries)
    Uniprot P61086 157-198
  8. 3060427Domain d6if1a2: 6if1 A:157-199 [360489]
    Other proteins in same PDB: d6if1a1, d6if1b1, d6if1c_, d6if1d_
    automated match to d1ylaa1

Details for d6if1a2

PDB Entry: 6if1 (more details), 2.47 Å

PDB Description: crystal structure of ube2k and k48-linked di-ubiquitin complex
PDB Compounds: (A:) Ubiquitin-conjugating enzyme E2 K

SCOPe Domain Sequences for d6if1a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6if1a2 a.5.2.1 (A:157-199) Ubiquitin-conjugating enzyme E2-25 kDa, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
vsspeytkkienlcamgfdrnavivalsskswdvetatellls

SCOPe Domain Coordinates for d6if1a2:

Click to download the PDB-style file with coordinates for d6if1a2.
(The format of our PDB-style files is described here.)

Timeline for d6if1a2:

  • d6if1a2 appears in periodic updates to SCOPe 2.07 starting on 2018-11-22