SCOPe 2.08: Domain d1hfel1: 1hfe L:87-398

Lineage for d1hfel1 (1hfe L:87-398)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.96: Fe-only hydrogenase [53919] (1 superfamily)
   consist of two intertwined domains; contains partial duplication

4. Superfamily c.96.1: Fe-only hydrogenase [53920] (1 family)
   automatically mapped to Pfam PF02906

5. Family c.96.1.1: Fe-only hydrogenase [53921] (3 proteins)

6. Protein Fe-only hydrogenase larger subunit, C-domain [53924] (1 species)

7. Species Desulfovibrio desulfuricans [TaxId:876] [53925] (1 PDB entry)

8. Domain d1hfel1: 1hfe L:87-398 [36018]
   Other proteins in same PDB: d1hfel2, d1hfem2, d1hfes_, d1hfet_
   complexed with cmo, cyn, cys, fe2, pdt, sf4, zn

Details for d1hfel1

PDB Entry: 1hfe, 1.6 Å

PDB Description: 1.6 a resolution structure of the fe-only hydrogenase from desulfovibrio desulfuricans

PDB Compounds: (L:) protein (fe-only hydrogenase (e.c.1.18.99.1) (larger subunit))

SCOPe Domain Sequences for d1hfel1:

Sequence; same for both SEQRES and ATOM records:

>d1hfel1 c.96.1.1 (L:87-398) Fe-only hydrogenase larger subunit, C-domain {Desulfovibrio desulfuricans [TaxId: 876]}
wvpevekklkdgkvkciampapavryalgdafgmpvgsvttgkmlaalqklgfahcwdte
ftadvtiweegsefverltkksdmplpqftsccpgwqkyaetyypellphfstckspigm
ngalaktygaermkydpkqvytvsimpciakkyeglrpelkssgmrdidatlttrelaym
ikkagidfaklpdgkrdslmgestggatifgvtggvmeaalrfayeavtgkkpdswdfka
vrgldgikeatvnvggtdvkvavvhgakrfkqvcddvkagkspyhfieymacpggcvcgg
gqpvmpgvleam

Timeline for d1hfel1:

• d1hfel1 first appeared (with stable ids) in SCOP 1.55
  
• d1hfel1 appears in SCOPe 2.07