![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies) not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
![]() | Superfamily a.137.4: Fe-only hydrogenase smaller subunit [48674] (1 family) ![]() |
![]() | Family a.137.4.1: Fe-only hydrogenase smaller subunit [48675] (1 protein) |
![]() | Protein Fe-only hydrogenase smaller subunit [48676] (1 species) string of short helices wrapped around the larger subunit |
![]() | Species Desulfovibrio desulfuricans [TaxId:876] [48677] (1 PDB entry) |
![]() | Domain d1hfes_: 1hfe S: [19640] Other proteins in same PDB: d1hfel1, d1hfel2, d1hfem1, d1hfem2 complexed with cmo, cyn, cys, fe2, pdt, sf4, zn |
PDB Entry: 1hfe (more details), 1.6 Å
SCOPe Domain Sequences for d1hfes_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hfes_ a.137.4.1 (S:) Fe-only hydrogenase smaller subunit {Desulfovibrio desulfuricans [TaxId: 876]} vkqikdymldringvygadakfpvrasqdntqvkalyksylekplghkshdllhthwfdk skgvkelttagklpnprasefegpypye
Timeline for d1hfes_: