Lineage for d5zteh_ (5zte H:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2878967Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2878968Protein automated matches [190056] (195 species)
    not a true protein
  7. 2880382Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [196344] (34 PDB entries)
  8. 2880478Domain d5zteh_: 5zte H: [358738]
    Other proteins in same PDB: d5ztea2, d5zteb1, d5zteb2, d5zted2, d5ztef2
    automated match to d3qpmd_
    mutant

Details for d5zteh_

PDB Entry: 5zte (more details), 2.6 Å

PDB Description: crystal structure of prxa c119s mutant from arabidopsis thaliana
PDB Compounds: (H:) 2-Cys peroxiredoxin BAS1, chloroplastic

SCOPe Domain Sequences for d5zteh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5zteh_ c.47.1.0 (H:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
plvgnkapdfeaeavfdqefikvklsdyigkkyvilffypldftfvspteitafsdrhse
feklntevlgvsvdsvfshlawvqtdrksgglgdlnyplisdvtksisksfgvlihdqgi
alrglfiidkegviqhstinnlgigrsvdetmrtlqalqyiqenpdevcpagwkpgeksm
kpdpklskeyfsa

SCOPe Domain Coordinates for d5zteh_:

Click to download the PDB-style file with coordinates for d5zteh_.
(The format of our PDB-style files is described here.)

Timeline for d5zteh_: