Lineage for d5zteb1 (5zte B:73-264)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2455315Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2455316Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2456544Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins)
  6. 2456952Protein automated matches [190100] (19 species)
    not a true protein
  7. 3058681Species Arabidopsis thaliana [TaxId:3702] [358743] (1 PDB entry)
  8. 3058682Domain d5zteb1: 5zte B:73-264 [358744]
    Other proteins in same PDB: d5ztea1, d5ztea2, d5zteb2, d5ztec_, d5zted1, d5zted2, d5ztee_, d5ztef1, d5ztef2, d5zteg_, d5zteh_, d5ztei_, d5ztej_
    automated match to d1qmva_

Details for d5zteb1

PDB Entry: 5zte (more details), 2.6 Å

PDB Description: crystal structure of prx
PDB Compounds: (B:) 2-Cys peroxiredoxin BAS1, chloroplastic

SCOPe Domain Sequences for d5zteb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5zteb1 c.47.1.10 (B:73-264) automated matches {Arabidopsis thaliana [TaxId: 3702]}
plvgnkapdfeaeavfdqefikvklsdyigkkyvilffypldftfvspteitafsdrhse
feklntevlgvsvdsvfshlawvqtdrksgglgdlnyplisdvtksisksfgvlihdqgi
alrglfiidkegviqhstinnlgigrsvdetmrtlqalqyiqenpdevcpagwkpgeksm
kpdpklskeyfs

SCOPe Domain Coordinates for d5zteb1:

Click to download the PDB-style file with coordinates for d5zteb1.
(The format of our PDB-style files is described here.)

Timeline for d5zteb1:

  • d5zteb1 appears in periodic updates to SCOPe 2.07 starting on 2018-10-11