PDB entry 5zte

View 5zte on RCSB PDB site
Description: Crystal structure of Prx
Class: oxidoreductase
Keywords: Arabidopsis thaliana; redox regulation; chloroplast thioredoxin systems; oxidative and photo-oxidative stress., OXIDOREDUCTASE
Deposited on 2018-05-03, released 2018-10-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-10-10, with a file datestamp of 2018-10-05.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 2-Cys peroxiredoxin BAS1, chloroplastic
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: BAS1, At3g11630, F24K9.28, T19F11.3
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q96291 (1-194)
      • engineered mutation (47)
      • expression tag (195)
    Domains in SCOPe 2.07: d5ztea1, d5ztea2
  • Chain 'B':
    Compound: 2-Cys peroxiredoxin BAS1, chloroplastic
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: BAS1, At3g11630, F24K9.28, T19F11.3
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q96291 (1-End)
      • engineered mutation (47)
      • expression tag (197-202)
    Domains in SCOPe 2.07: d5zteb1, d5zteb2
  • Chain 'C':
    Compound: 2-Cys peroxiredoxin BAS1, chloroplastic
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: BAS1, At3g11630, F24K9.28, T19F11.3
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q96291 (1-End)
      • engineered mutation (47)
    Domains in SCOPe 2.07: d5ztec_
  • Chain 'D':
    Compound: 2-Cys peroxiredoxin BAS1, chloroplastic
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: BAS1, At3g11630, F24K9.28, T19F11.3
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q96291 (1-194)
      • engineered mutation (47)
      • expression tag (195)
    Domains in SCOPe 2.07: d5zted1, d5zted2
  • Chain 'E':
    Compound: 2-Cys peroxiredoxin BAS1, chloroplastic
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: BAS1, At3g11630, F24K9.28, T19F11.3
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q96291 (1-194)
      • engineered mutation (47)
    Domains in SCOPe 2.07: d5ztee_
  • Chain 'F':
    Compound: 2-Cys peroxiredoxin BAS1, chloroplastic
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: BAS1, At3g11630, F24K9.28, T19F11.3
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q96291 (1-194)
      • engineered mutation (47)
      • expression tag (195-196)
    Domains in SCOPe 2.07: d5ztef1, d5ztef2
  • Chain 'G':
    Compound: 2-Cys peroxiredoxin BAS1, chloroplastic
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: BAS1, At3g11630, F24K9.28, T19F11.3
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q96291 (1-End)
      • engineered mutation (47)
    Domains in SCOPe 2.07: d5zteg_
  • Chain 'H':
    Compound: 2-Cys peroxiredoxin BAS1, chloroplastic
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: BAS1, At3g11630, F24K9.28, T19F11.3
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q96291 (1-End)
      • engineered mutation (47)
    Domains in SCOPe 2.07: d5zteh_
  • Chain 'I':
    Compound: 2-Cys peroxiredoxin BAS1, chloroplastic
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: BAS1, At3g11630, F24K9.28, T19F11.3
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q96291 (1-194)
      • engineered mutation (47)
    Domains in SCOPe 2.07: d5ztei_
  • Chain 'J':
    Compound: 2-Cys peroxiredoxin BAS1, chloroplastic
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: BAS1, At3g11630, F24K9.28, T19F11.3
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q96291 (1-194)
      • engineered mutation (47)
    Domains in SCOPe 2.07: d5ztej_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5zteA (A:)
    mplvgnkapdfeaeavfdqefikvklsdyigkkyvilffypldftfvspteitafsdrhs
    efeklntevlgvsvdsvfshlawvqtdrksgglgdlnyplisdvtksisksfgvlihdqg
    ialrglfiidkegviqhstinnlgigrsvdetmrtlqalqyiqenpdevcpagwkpgeks
    mkpdpklskeyfsailehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zteA (A:)
    plvgnkapdfeaeavfdqefikvklsdyigkkyvilffypldftfvspteitafsdrhse
    feklntevlgvsvdsvfshlawvqtdrksgglgdlnyplisdvtksisksfgvlihdqgi
    alrglfiidkegviqhstinnlgigrsvdetmrtlqalqyiqenpdevcpagwkpgeksm
    kpdpklskeyfsail
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5zteB (B:)
    mplvgnkapdfeaeavfdqefikvklsdyigkkyvilffypldftfvspteitafsdrhs
    efeklntevlgvsvdsvfshlawvqtdrksgglgdlnyplisdvtksisksfgvlihdqg
    ialrglfiidkegviqhstinnlgigrsvdetmrtlqalqyiqenpdevcpagwkpgeks
    mkpdpklskeyfsailehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zteB (B:)
    plvgnkapdfeaeavfdqefikvklsdyigkkyvilffypldftfvspteitafsdrhse
    feklntevlgvsvdsvfshlawvqtdrksgglgdlnyplisdvtksisksfgvlihdqgi
    alrglfiidkegviqhstinnlgigrsvdetmrtlqalqyiqenpdevcpagwkpgeksm
    kpdpklskeyfshhhhhh
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5zteC (C:)
    mplvgnkapdfeaeavfdqefikvklsdyigkkyvilffypldftfvspteitafsdrhs
    efeklntevlgvsvdsvfshlawvqtdrksgglgdlnyplisdvtksisksfgvlihdqg
    ialrglfiidkegviqhstinnlgigrsvdetmrtlqalqyiqenpdevcpagwkpgeks
    mkpdpklskeyfsailehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zteC (C:)
    plvgnkapdfeaeavfdqefikvklsdyigkkyvilffypldftfvspteitafsdrhse
    feklntevlgvsvdsvfshlawvqtdrksgglgdlnyplisdvtksisksfgvlihdqgi
    alrglfiidkegviqhstinnlgigrsvdetmrtlqalqyiqenpdevcpagwkpgeksm
    kpdpklskeyfsa
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5zteD (D:)
    mplvgnkapdfeaeavfdqefikvklsdyigkkyvilffypldftfvspteitafsdrhs
    efeklntevlgvsvdsvfshlawvqtdrksgglgdlnyplisdvtksisksfgvlihdqg
    ialrglfiidkegviqhstinnlgigrsvdetmrtlqalqyiqenpdevcpagwkpgeks
    mkpdpklskeyfsailehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zteD (D:)
    plvgnkapdfeaeavfdqefikvklsdyigkkyvilffypldftfvspteitafsdrhse
    feklntevlgvsvdsvfshlawvqtdrksgglgdlnyplisdvtksisksfgvlihdqgi
    alrglfiidkegviqhstinnlgigrsvdetmrtlqalqyiqenpdevcpagwkpgeksm
    kpdpklskeyfsail
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5zteE (E:)
    mplvgnkapdfeaeavfdqefikvklsdyigkkyvilffypldftfvspteitafsdrhs
    efeklntevlgvsvdsvfshlawvqtdrksgglgdlnyplisdvtksisksfgvlihdqg
    ialrglfiidkegviqhstinnlgigrsvdetmrtlqalqyiqenpdevcpagwkpgeks
    mkpdpklskeyfsailehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zteE (E:)
    plvgnkapdfeaeavfdqefikvklsdyigkkyvilffypldftfvspteitafsdrhse
    feklntevlgvsvdsvfshlawvqtdrksgglgdlnyplisdvtksisksfgvlihdqgi
    alrglfiidkegviqhstinnlgigrsvdetmrtlqalqyiqenpdevcpagwkpgeksm
    kpdpklskeyfsai
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5zteF (F:)
    mplvgnkapdfeaeavfdqefikvklsdyigkkyvilffypldftfvspteitafsdrhs
    efeklntevlgvsvdsvfshlawvqtdrksgglgdlnyplisdvtksisksfgvlihdqg
    ialrglfiidkegviqhstinnlgigrsvdetmrtlqalqyiqenpdevcpagwkpgeks
    mkpdpklskeyfsailehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zteF (F:)
    plvgnkapdfeaeavfdqefikvklsdyigkkyvilffypldftfvspteitafsdrhse
    feklntevlgvsvdsvfshlawvqtdrksgglgdlnyplisdvtksisksfgvlihdqgi
    alrglfiidkegviqhstinnlgigrsvdetmrtlqalqyiqenpdevcpagwkpgeksm
    kpdpklskeyfsaile
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >5zteG (G:)
    mplvgnkapdfeaeavfdqefikvklsdyigkkyvilffypldftfvspteitafsdrhs
    efeklntevlgvsvdsvfshlawvqtdrksgglgdlnyplisdvtksisksfgvlihdqg
    ialrglfiidkegviqhstinnlgigrsvdetmrtlqalqyiqenpdevcpagwkpgeks
    mkpdpklskeyfsailehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zteG (G:)
    plvgnkapdfeaeavfdqefikvklsdyigkkyvilffypldftfvspteitafsdrhse
    feklntevlgvsvdsvfshlawvqtdrksgglgdlnyplisdvtksisksfgvlihdqgi
    alrglfiidkegviqhstinnlgigrsvdetmrtlqalqyiqenpdevcpagwkpgeksm
    kpdpkls
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >5zteH (H:)
    mplvgnkapdfeaeavfdqefikvklsdyigkkyvilffypldftfvspteitafsdrhs
    efeklntevlgvsvdsvfshlawvqtdrksgglgdlnyplisdvtksisksfgvlihdqg
    ialrglfiidkegviqhstinnlgigrsvdetmrtlqalqyiqenpdevcpagwkpgeks
    mkpdpklskeyfsailehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zteH (H:)
    plvgnkapdfeaeavfdqefikvklsdyigkkyvilffypldftfvspteitafsdrhse
    feklntevlgvsvdsvfshlawvqtdrksgglgdlnyplisdvtksisksfgvlihdqgi
    alrglfiidkegviqhstinnlgigrsvdetmrtlqalqyiqenpdevcpagwkpgeksm
    kpdpklskeyfsa
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >5zteI (I:)
    mplvgnkapdfeaeavfdqefikvklsdyigkkyvilffypldftfvspteitafsdrhs
    efeklntevlgvsvdsvfshlawvqtdrksgglgdlnyplisdvtksisksfgvlihdqg
    ialrglfiidkegviqhstinnlgigrsvdetmrtlqalqyiqenpdevcpagwkpgeks
    mkpdpklskeyfsailehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zteI (I:)
    plvgnkapdfeaeavfdqefikvklsdyigkkyvilffypldftfvspteitafsdrhse
    feklntevlgvsvdsvfshlawvqtdrksgglgdlnyplisdvtksisksfgvlihdqgi
    alrglfiidkegviqhstinnlgigrsvdetmrtlqalqyiqenpdevcpagwkpgeksm
    kpdpklskeyfsai
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >5zteJ (J:)
    mplvgnkapdfeaeavfdqefikvklsdyigkkyvilffypldftfvspteitafsdrhs
    efeklntevlgvsvdsvfshlawvqtdrksgglgdlnyplisdvtksisksfgvlihdqg
    ialrglfiidkegviqhstinnlgigrsvdetmrtlqalqyiqenpdevcpagwkpgeks
    mkpdpklskeyfsailehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zteJ (J:)
    plvgnkapdfeaeavfdqefikvklsdyigkkyvilffypldftfvspteitafsdrhse
    feklntevlgvsvdsvfshlawvqtdrksgglgdlnyplisdvtksisksfgvlihdqgi
    alrglfiidkegviqhstinnlgigrsvdetmrtlqalqyiqenpdevcpagwkpgeksm
    kpdpklskeyfsai