Lineage for d6if8b1 (6if8 B:1-230)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2887810Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 2887827Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families) (S)
    complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8
  5. 2888846Family c.56.2.0: automated matches [191488] (1 protein)
    not a true family
  6. 2888847Protein automated matches [190781] (46 species)
    not a true protein
  7. 2888855Species Aeromonas hydrophila [TaxId:380703] [327104] (5 PDB entries)
  8. 2888865Domain d6if8b1: 6if8 B:1-230 [358360]
    Other proteins in same PDB: d6if8a2, d6if8b2, d6if8c2, d6if8d2
    automated match to d4f3ka_
    complexed with ade

Details for d6if8b1

PDB Entry: 6if8 (more details), 2 Å

PDB Description: aeromonas hydrophila mtan-2 complexed with adenine
PDB Compounds: (B:) 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase

SCOPe Domain Sequences for d6if8b1:

Sequence, based on SEQRES records: (download)

>d6if8b1 c.56.2.0 (B:1-230) automated matches {Aeromonas hydrophila [TaxId: 380703]}
mkvgiigameqevallrsqmsnpttlqlggcefyqgtlagkeviltrsgigkvaasvats
lllekfapdcvintgsaggfaqdlhigdvviasemrfhdvdvtafgyemgqmaqqpaafp
cdetliavaqdciaeqgkhqtkvglictgdqfmckpdaiakaradfpqmlavemegaaig
qvchmfkvpylvvramsdiagkeqvesfdafievagkhsaeviikmlgkl

Sequence, based on observed residues (ATOM records): (download)

>d6if8b1 c.56.2.0 (B:1-230) automated matches {Aeromonas hydrophila [TaxId: 380703]}
mkvgiigameqevallrsqmsnpttlqlggcefyqgtlagkeviltrsgigkvaasvats
lllekfapdcvintgsaggfaqdlhigdvviasemrfhdvdvtafgyemgqmaqqpaafp
cdetliavaqdckvglictgdqfmckpdaiakaradfpqmlavemegaaigqvchmfkvp
ylvvramsdiagkeqvesfdafievagkhsaeviikmlgkl

SCOPe Domain Coordinates for d6if8b1:

Click to download the PDB-style file with coordinates for d6if8b1.
(The format of our PDB-style files is described here.)

Timeline for d6if8b1: