PDB entry 6if8

View 6if8 on RCSB PDB site
Description: Aeromonas hydrophila MtaN-2 complexed with adenine
Class: hydrolase
Keywords: Aeromonas hydrophila, MtaN-2, Complex, Adenine, 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase, HYDROLASE
Deposited on 2018-09-18, released 2018-10-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-10-03, with a file datestamp of 2018-09-28.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase
    Species: Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) [TaxId:380703]
    Gene: mtnN, mtnN-2, AHA_1706
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0KIZ1 (30-259)
      • expression tag (24-29)
    Domains in SCOPe 2.07: d6if8a1, d6if8a2
  • Chain 'B':
    Compound: 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase
    Species: Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) [TaxId:380703]
    Gene: mtnN, mtnN-2, AHA_1706
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0KIZ1 (30-259)
      • expression tag (23-29)
    Domains in SCOPe 2.07: d6if8b1, d6if8b2
  • Chain 'C':
    Compound: 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase
    Species: Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) [TaxId:380703]
    Gene: mtnN, mtnN-2, AHA_1706
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0KIZ1 (30-259)
      • expression tag (24-29)
    Domains in SCOPe 2.07: d6if8c1, d6if8c2
  • Chain 'D':
    Compound: 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase
    Species: Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) [TaxId:380703]
    Gene: mtnN, mtnN-2, AHA_1706
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0KIZ1 (30-259)
      • expression tag (23-29)
    Domains in SCOPe 2.07: d6if8d1, d6if8d2
  • Heterogens: ADE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6if8A (A:)
    msyyhhhhhhdydipttenlyfqgamdpefmkvgiigameqevallrsqmsnpttlqlgg
    cefyqgtlagkeviltrsgigkvaasvatslllekfapdcvintgsaggfaqdlhigdvv
    iasemrfhdvdvtafgyemgqmaqqpaafpcdetliavaqdciaeqgkhqtkvglictgd
    qfmckpdaiakaradfpqmlavemegaaigqvchmfkvpylvvramsdiagkeqvesfda
    fievagkhsaeviikmlgkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6if8A (A:)
    amdpefmkvgiigameqevallrsqmsnpttlqlggcefyqgtlagkeviltrsgigkva
    asvatslllekfapdcvintgsaggfaqdlhigdvviasemrfhdvdvtafgyemgqmaq
    qpaafpcdetliavaqdckvglictgdqfmckpdaiakaradfpqmlavemegaaigqvc
    hmfkvpylvvramsdiagkeqvesfdafievagkhsaeviikmlgkl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6if8B (B:)
    msyyhhhhhhdydipttenlyfqgamdpefmkvgiigameqevallrsqmsnpttlqlgg
    cefyqgtlagkeviltrsgigkvaasvatslllekfapdcvintgsaggfaqdlhigdvv
    iasemrfhdvdvtafgyemgqmaqqpaafpcdetliavaqdciaeqgkhqtkvglictgd
    qfmckpdaiakaradfpqmlavemegaaigqvchmfkvpylvvramsdiagkeqvesfda
    fievagkhsaeviikmlgkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6if8B (B:)
    gamdpefmkvgiigameqevallrsqmsnpttlqlggcefyqgtlagkeviltrsgigkv
    aasvatslllekfapdcvintgsaggfaqdlhigdvviasemrfhdvdvtafgyemgqma
    qqpaafpcdetliavaqdckvglictgdqfmckpdaiakaradfpqmlavemegaaigqv
    chmfkvpylvvramsdiagkeqvesfdafievagkhsaeviikmlgkl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6if8C (C:)
    msyyhhhhhhdydipttenlyfqgamdpefmkvgiigameqevallrsqmsnpttlqlgg
    cefyqgtlagkeviltrsgigkvaasvatslllekfapdcvintgsaggfaqdlhigdvv
    iasemrfhdvdvtafgyemgqmaqqpaafpcdetliavaqdciaeqgkhqtkvglictgd
    qfmckpdaiakaradfpqmlavemegaaigqvchmfkvpylvvramsdiagkeqvesfda
    fievagkhsaeviikmlgkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6if8C (C:)
    amdpefmkvgiigameqevallrsqmsnpttlqlggcefyqgtlagkeviltrsgigkva
    asvatslllekfapdcvintgsaggfaqdlhigdvviasemrfhdvdvtafgyemgqmaq
    qpaafpcdetliavaqdckvglictgdqfmckpdaiakaradfpqmlavemegaaigqvc
    hmfkvpylvvramsdiagkeqvesfdafievagkhsaeviikmlgkl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6if8D (D:)
    msyyhhhhhhdydipttenlyfqgamdpefmkvgiigameqevallrsqmsnpttlqlgg
    cefyqgtlagkeviltrsgigkvaasvatslllekfapdcvintgsaggfaqdlhigdvv
    iasemrfhdvdvtafgyemgqmaqqpaafpcdetliavaqdciaeqgkhqtkvglictgd
    qfmckpdaiakaradfpqmlavemegaaigqvchmfkvpylvvramsdiagkeqvesfda
    fievagkhsaeviikmlgkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6if8D (D:)
    gamdpefmkvgiigameqevallrsqmsnpttlqlggcefyqgtlagkeviltrsgigkv
    aasvatslllekfapdcvintgsaggfaqdlhigdvviasemrfhdvdvtafgyemgqma
    qqpaafpcdetliavaqdckvglictgdqfmckpdaiakaradfpqmlavemegaaigqv
    chmfkvpylvvramsdiagkeqvesfdafievagkhsaeviikmlgkl