SCOPe 2.07: Domain d6bfqd2: 6bfq D:109-214

Lineage for d6bfqd2 (6bfq D:109-214)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (17 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1235 PDB entries)

8. Domain d6bfqd2: 6bfq D:109-214 [357277]
   Other proteins in same PDB: d6bfqb1, d6bfqd1, d6bfqf1, d6bfqg1, d6bfqg2, d6bfqi1, d6bfqi2, d6bfqj1, d6bfqj2, d6bfqk1, d6bfqk2, d6bfql1
   automated match to d1um5l2

Details for d6bfqd2

PDB Entry: 6bfq, 2.6 Å

PDB Description: the mechanism of gm-csf inhibition by human gm-csf auto-antibodies

PDB Compounds: (D:) Fab light chain

SCOPe Domain Sequences for d6bfqd2:

Sequence; same for both SEQRES and ATOM records:

>d6bfqd2 b.1.1.2 (D:109-214) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrge

Timeline for d6bfqd2:

• d6bfqd2 is new in SCOPe 2.07-stable
  
• d6bfqd2 appears in the current release, SCOPe 2.08