Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein automated matches [190374] (17 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187221] (1235 PDB entries) |
Domain d6bfqd2: 6bfq D:109-214 [357277] Other proteins in same PDB: d6bfqb1, d6bfqd1, d6bfqf1, d6bfqg1, d6bfqg2, d6bfqi1, d6bfqi2, d6bfqj1, d6bfqj2, d6bfqk1, d6bfqk2, d6bfql1 automated match to d1um5l2 |
PDB Entry: 6bfq (more details), 2.6 Å
SCOPe Domain Sequences for d6bfqd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6bfqd2 b.1.1.2 (D:109-214) automated matches {Human (Homo sapiens) [TaxId: 9606]} rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrge
Timeline for d6bfqd2: