SCOPe 2.07: Domain d6bfqi1: 6bfq I:23-110

Lineage for d6bfqi1 (6bfq I:23-110)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.26: 4-helical cytokines [47265] (1 superfamily)
   core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections

4. Superfamily a.26.1: 4-helical cytokines [47266] (4 families)
   there are two different topoisomers of this fold with different entanglements of the two crossover connections

5. Family a.26.1.2: Short-chain cytokines [47286] (14 proteins)

6. Protein automated matches [190501] (4 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187448] (23 PDB entries)

8. Domain d6bfqi1: 6bfq I:23-110 [357362]
   Other proteins in same PDB: d6bfqb1, d6bfqb2, d6bfqd1, d6bfqd2, d6bfqf1, d6bfqf2, d6bfqg2, d6bfqi2, d6bfqj2, d6bfqk2, d6bfql1, d6bfql2
   automated match to d5d22b_

Details for d6bfqi1

PDB Entry: 6bfq, 2.6 Å

PDB Description: the mechanism of gm-csf inhibition by human gm-csf auto-antibodies

PDB Compounds: (I:) granulocyte-macrophage colony-stimulating factor

SCOPe Domain Sequences for d6bfqi1:

Sequence, based on SEQRES records:

>d6bfqi1 a.26.1.2 (I:23-110) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rrllnlsrdtaaemnetvevisemfdlqeptclqtrlelykqglrgsltklkgpltmmas
hykqhcpptpetscatqiitfesfkenl

Sequence, based on observed residues (ATOM records):

>d6bfqi1 a.26.1.2 (I:23-110) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rrllnlmnetvevisemfdlqeptclqtrlelykqglrgsltklkgpltmmashykqhcp
ptpetscatqiitfesfkenl

Timeline for d6bfqi1:

• d6bfqi1 is new in SCOPe 2.07-stable
  
• d6bfqi1 appears in the current release, SCOPe 2.08