Lineage for d5zw7a2 (5zw7 A:231-383)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2706693Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 2708344Superfamily a.29.3: Acyl-CoA dehydrogenase C-terminal domain-like [47203] (3 families) (S)
    multidomain flavoprotein; N-terminal domain is all-alpha; the middle domain is open (5,8) barrel
  5. 2708478Family a.29.3.0: automated matches [227204] (1 protein)
    not a true family
  6. 2708479Protein automated matches [226935] (30 species)
    not a true protein
  7. 2708686Species Serratia sp. [TaxId:104623] [357159] (5 PDB entries)
  8. 2708687Domain d5zw7a2: 5zw7 A:231-383 [357207]
    Other proteins in same PDB: d5zw7a1
    automated match to d3mpia2
    complexed with cl, fad, gol, o4b

Details for d5zw7a2

PDB Entry: 5zw7 (more details), 1.3 Å

PDB Description: fad-piga complex at 1.3 a
PDB Compounds: (A:) L-prolyl-[peptidyl-carrier protein] dehydrogenase

SCOPe Domain Sequences for d5zw7a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5zw7a2 a.29.3.0 (A:231-383) automated matches {Serratia sp. [TaxId: 104623]}
gaggaifhdsmiwekgclsalfvgglarllettleyakarqqfgkaigqfqsvsnriidm
klrleqcrlmlyracwkhdqgqdaeadiamsklliseyavqsgldaiqtfggaamdqelg
lvrhllnmipsrifsgtndiqkeiiarklglrg

SCOPe Domain Coordinates for d5zw7a2:

Click to download the PDB-style file with coordinates for d5zw7a2.
(The format of our PDB-style files is described here.)

Timeline for d5zw7a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5zw7a1