PDB entry 5zw7

View 5zw7 on RCSB PDB site
Description: FAD-PigA complex at 1.3 A
Class: biosynthetic protein
Keywords: red pigment, pyrrole, acyl-CoA oxidase, FAD, tetramer, BIOSYNTHETIC PROTEIN
Deposited on 2018-05-14, released 2018-09-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-09-05, with a file datestamp of 2018-08-31.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: N/A
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: L-prolyl-[peptidyl-carrier protein] dehydrogenase
    Species: Serratia sp. (strain ATCC 39006) [TaxId:104623]
    Gene: pigA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5zw7a1, d5zw7a2
  • Heterogens: FAD, O4B, GOL, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5zw7A (A:)
    mdfnlsnsqsdiyesayrfacdvldqdaqtrisqkilstelwkkaaaygfahgpvshqfg
    gselgaldtalmiealgkgsrdiglsfslcahlcacviplyrfgsselkdkyleslvtgk
    liaanaatepdagsdiynmqataqpceggyilngkkifitnapiadvfiiyaktnpdhgf
    lgvsafliekgtpglnvgevipkdclsncpwseivfndifipqsqrigmegaggaifhds
    miwekgclsalfvgglarllettleyakarqqfgkaigqfqsvsnriidmklrleqcrlm
    lyracwkhdqgqdaeadiamsklliseyavqsgldaiqtfggaamdqelglvrhllnmip
    srifsgtndiqkeiiarklglrgtssgslvprgshhhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zw7A (A:)
    mdfnlsnsqsdiyesayrfacdvldqdaqtrisqkilstelwkkaaaygfahgpvshqfg
    gselgaldtalmiealgkgsrdiglsfslcahlcacviplyrfgsselkdkyleslvtgk
    liaanaatepdagsdiynmqataqpceggyilngkkifitnapiadvfiiyaktnpdhgf
    lgvsafliekgtpglnvgevipkdclsncpwseivfndifipqsqrigmegaggaifhds
    miwekgclsalfvgglarllettleyakarqqfgkaigqfqsvsnriidmklrleqcrlm
    lyracwkhdqgqdaeadiamsklliseyavqsgldaiqtfggaamdqelglvrhllnmip
    srifsgtndiqkeiiarklglrg