Lineage for d6grrb4 (6grr B:301-725)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2391115Fold b.30: Supersandwich [49993] (3 superfamilies)
    sandwich; 18 strands in 2 sheets
  4. 2391116Superfamily b.30.2: Amine oxidase catalytic domain [49998] (1 family) (S)
    automatically mapped to Pfam PF01179
  5. 2391117Family b.30.2.1: Amine oxidase catalytic domain [49999] (3 proteins)
  6. 2391254Protein automated matches [356739] (2 species)
    not a true protein
  7. 2391255Species Escherichia coli [TaxId:562] [357052] (1 PDB entry)
  8. 2391257Domain d6grrb4: 6grr B:301-725 [357199]
    Other proteins in same PDB: d6grra1, d6grra2, d6grra3, d6grrb1, d6grrb2, d6grrb3
    automated match to d1oaca1
    complexed with ca, cu, gol; mutant

Details for d6grrb4

PDB Entry: 6grr (more details), 1.7 Å

PDB Description: crystal structure of escherichia coli amine oxidase mutant i342f/e573q
PDB Compounds: (B:) amine oxidase

SCOPe Domain Sequences for d6grrb4:

Sequence; same for both SEQRES and ATOM records: (download)

>d6grrb4 b.30.2.1 (B:301-725) automated matches {Escherichia coli [TaxId: 562]}
pavkpmqiiepegknytitgdmihwrnwdfhlsmnsrvgpmfstvtyndngtkrkvmyeg
slggmivpygdpdigwyfkayldsgdygmgtltspiargkdapsnavllnetiadytgvp
meipraiavferyagpeykhqemgqpnvsterrelvvrwistvgnydyifdwifhengti
gidagatgieavkgvkaktmhdetakddtrygtlidhnivgtthqhiynfrldldvdgen
nslvamdpvvkpntaggprtstmqvnqynignqqdaaqkfdpgtirllsnpnkenrmgnp
vsyqiipyaggthpvakgaqfapdewiyhrlsfmdkqlwvtryhpgerfpegkypnrsth
dtglgqyskdnesldntdavvwmttgtthvaraeewpimptewvhtllkpwnffdetptl
galkk

SCOPe Domain Coordinates for d6grrb4:

Click to download the PDB-style file with coordinates for d6grrb4.
(The format of our PDB-style files is described here.)

Timeline for d6grrb4: