Class b: All beta proteins [48724] (178 folds) |
Fold b.30: Supersandwich [49993] (3 superfamilies) sandwich; 18 strands in 2 sheets |
Superfamily b.30.2: Amine oxidase catalytic domain [49998] (1 family) automatically mapped to Pfam PF01179 |
Family b.30.2.1: Amine oxidase catalytic domain [49999] (3 proteins) |
Protein automated matches [356739] (2 species) not a true protein |
Species Escherichia coli [TaxId:562] [357052] (1 PDB entry) |
Domain d6grra4: 6grr A:301-724 [357053] Other proteins in same PDB: d6grra1, d6grra2, d6grra3, d6grrb1, d6grrb2, d6grrb3 automated match to d1oaca1 complexed with ca, cu, gol; mutant |
PDB Entry: 6grr (more details), 1.7 Å
SCOPe Domain Sequences for d6grra4:
Sequence; same for both SEQRES and ATOM records: (download)
>d6grra4 b.30.2.1 (A:301-724) automated matches {Escherichia coli [TaxId: 562]} pavkpmqiiepegknytitgdmihwrnwdfhlsmnsrvgpmfstvtyndngtkrkvmyeg slggmivpygdpdigwyfkayldsgdygmgtltspiargkdapsnavllnetiadytgvp meipraiavferyagpeykhqemgqpnvsterrelvvrwistvgnydyifdwifhengti gidagatgieavkgvkaktmhdetakddtrygtlidhnivgtthqhiynfrldldvdgen nslvamdpvvkpntaggprtstmqvnqynignqqdaaqkfdpgtirllsnpnkenrmgnp vsyqiipyaggthpvakgaqfapdewiyhrlsfmdkqlwvtryhpgerfpegkypnrsth dtglgqyskdnesldntdavvwmttgtthvaraeewpimptewvhtllkpwnffdetptl galk
Timeline for d6grra4:
View in 3D Domains from other chains: (mouse over for more information) d6grrb1, d6grrb2, d6grrb3, d6grrb4 |