Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
Superfamily d.17.2: Amine oxidase N-terminal region [54416] (2 families) |
Family d.17.2.0: automated matches [356734] (1 protein) not a true family |
Protein automated matches [356735] (2 species) not a true protein |
Species Escherichia coli [TaxId:562] [357049] (1 PDB entry) |
Domain d6grra2: 6grr A:91-185 [357050] Other proteins in same PDB: d6grra1, d6grra4, d6grrb1, d6grrb4 automated match to d1oaca2 complexed with ca, cu, gol; mutant |
PDB Entry: 6grr (more details), 1.7 Å
SCOPe Domain Sequences for d6grra2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6grra2 d.17.2.0 (A:91-185) automated matches {Escherichia coli [TaxId: 562]} krphplnaltadeikqaveivkasadfkpntrfteisllppdkeavwafalenkpvdqpr kadvimldgkhiieavvdlqnnkllswqpikdahg
Timeline for d6grra2:
View in 3D Domains from other chains: (mouse over for more information) d6grrb1, d6grrb2, d6grrb3, d6grrb4 |