Lineage for d6grra2 (6grr A:91-185)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2542783Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 2543045Superfamily d.17.2: Amine oxidase N-terminal region [54416] (2 families) (S)
  5. 2543312Family d.17.2.0: automated matches [356734] (1 protein)
    not a true family
  6. 2543313Protein automated matches [356735] (2 species)
    not a true protein
  7. 2543314Species Escherichia coli [TaxId:562] [357049] (1 PDB entry)
  8. 2543315Domain d6grra2: 6grr A:91-185 [357050]
    Other proteins in same PDB: d6grra1, d6grra4, d6grrb1, d6grrb4
    automated match to d1oaca2
    complexed with ca, cu, gol; mutant

Details for d6grra2

PDB Entry: 6grr (more details), 1.7 Å

PDB Description: crystal structure of escherichia coli amine oxidase mutant i342f/e573q
PDB Compounds: (A:) amine oxidase

SCOPe Domain Sequences for d6grra2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6grra2 d.17.2.0 (A:91-185) automated matches {Escherichia coli [TaxId: 562]}
krphplnaltadeikqaveivkasadfkpntrfteisllppdkeavwafalenkpvdqpr
kadvimldgkhiieavvdlqnnkllswqpikdahg

SCOPe Domain Coordinates for d6grra2:

Click to download the PDB-style file with coordinates for d6grra2.
(The format of our PDB-style files is described here.)

Timeline for d6grra2: