Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.82: N domain of copper amine oxidase-like [55382] (5 superfamilies) alpha-beta(5)-alpha; 2 layers: alpha/beta; meander antiparallel sheet |
Superfamily d.82.1: Copper amine oxidase, domain N [55383] (2 families) automatically mapped to Pfam PF07833 |
Family d.82.1.0: automated matches [356730] (1 protein) not a true family |
Protein automated matches [356731] (2 species) not a true protein |
Species Escherichia coli [TaxId:562] [357047] (1 PDB entry) |
Domain d6grrb1: 6grr B:6-90 [357196] Other proteins in same PDB: d6grra2, d6grra3, d6grra4, d6grrb2, d6grrb3, d6grrb4 automated match to d1d6za4 complexed with ca, cu, gol; mutant |
PDB Entry: 6grr (more details), 1.7 Å
SCOPe Domain Sequences for d6grrb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6grrb1 d.82.1.0 (B:6-90) automated matches {Escherichia coli [TaxId: 562]} hmvpmdktlkefgadvqwddyaqlftlikdgayvkvkpgaqtaivngqplalqvpvvmkd nkawvsdtfindvfqsgldqtfqve
Timeline for d6grrb1:
View in 3D Domains from other chains: (mouse over for more information) d6grra1, d6grra2, d6grra3, d6grra4 |