SCOPe 2.08: Domain d6b9zc1: 6b9z C:4-54

Lineage for d6b9zc1 (6b9z C:4-54)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.8: immunoglobulin/albumin-binding domain-like [46996] (11 superfamilies)
   3 helices; bundle, closed, left-handed twist; up-and-down; mirror topology to the spectrin-like fold

4. Superfamily a.8.1: Bacterial immunoglobulin/albumin-binding domains [46997] (3 families)

5. Family a.8.1.1: Immunoglobulin-binding protein A modules [46998] (2 proteins)
   automatically mapped to Pfam PF02216

6. Protein Immunoglobulin-binding protein A modules [46999] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [47000] (27 PDB entries)

8. Domain d6b9zc1: 6b9z C:4-54 [356992]
   Other proteins in same PDB: d6b9za1, d6b9za2, d6b9zb_, d6b9zc2, d6b9ze1, d6b9ze2
   automated match to d3qwoc_

Details for d6b9zc1

PDB Entry: 6b9z, 1.82 Å

PDB Description: trastuzumab fab v3

PDB Compounds: (C:) immunoglobulin g binding protein a

SCOPe Domain Sequences for d6b9zc1:

Sequence; same for both SEQRES and ATOM records:

>d6b9zc1 a.8.1.1 (C:4-54) Immunoglobulin-binding protein A modules {Staphylococcus aureus [TaxId: 1280]}
nkdqqsafyeilnmpnlneaqrngfiqslkddpsqstnvlgeakklnesqa

Timeline for d6b9zc1:

• d6b9zc1 first appeared in SCOPe 2.07