Lineage for d6b9zc1 (6b9z C:4-54)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2309262Fold a.8: immunoglobulin/albumin-binding domain-like [46996] (11 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down; mirror topology to the spectrin-like fold
  4. 2309263Superfamily a.8.1: Bacterial immunoglobulin/albumin-binding domains [46997] (3 families) (S)
  5. 2309264Family a.8.1.1: Immunoglobulin-binding protein A modules [46998] (2 proteins)
    automatically mapped to Pfam PF02216
  6. 2309358Protein automated matches [191290] (5 species)
    not a true protein
  7. 2309366Species Staphylococcus aureus [TaxId:1280] [189943] (16 PDB entries)
  8. 3056930Domain d6b9zc1: 6b9z C:4-54 [356992]
    Other proteins in same PDB: d6b9za1, d6b9za2, d6b9zc2, d6b9ze1, d6b9ze2
    automated match to d3qwoc_

Details for d6b9zc1

PDB Entry: 6b9z (more details), 1.82 Å

PDB Description: trastuzumab fab v3
PDB Compounds: (C:) immunoglobulin g binding protein a

SCOPe Domain Sequences for d6b9zc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6b9zc1 a.8.1.1 (C:4-54) automated matches {Staphylococcus aureus [TaxId: 1280]}
nkdqqsafyeilnmpnlneaqrngfiqslkddpsqstnvlgeakklnesqa

SCOPe Domain Coordinates for d6b9zc1:

Click to download the PDB-style file with coordinates for d6b9zc1.
(The format of our PDB-style files is described here.)

Timeline for d6b9zc1:

  • d6b9zc1 appears in periodic updates to SCOPe 2.07 starting on 2018-09-06