Class a: All alpha proteins [46456] (290 folds) |
Fold a.8: immunoglobulin/albumin-binding domain-like [46996] (11 superfamilies) 3 helices; bundle, closed, left-handed twist; up-and-down; mirror topology to the spectrin-like fold |
Superfamily a.8.1: Bacterial immunoglobulin/albumin-binding domains [46997] (3 families) |
Family a.8.1.1: Immunoglobulin-binding protein A modules [46998] (2 proteins) automatically mapped to Pfam PF02216 |
Protein Immunoglobulin-binding protein A modules [46999] (1 species) |
Species Staphylococcus aureus [TaxId:1280] [47000] (27 PDB entries) |
Domain d6b9zc1: 6b9z C:4-54 [356992] Other proteins in same PDB: d6b9za1, d6b9za2, d6b9zb_, d6b9zc2, d6b9ze1, d6b9ze2 automated match to d3qwoc_ |
PDB Entry: 6b9z (more details), 1.82 Å
SCOPe Domain Sequences for d6b9zc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6b9zc1 a.8.1.1 (C:4-54) Immunoglobulin-binding protein A modules {Staphylococcus aureus [TaxId: 1280]} nkdqqsafyeilnmpnlneaqrngfiqslkddpsqstnvlgeakklnesqa
Timeline for d6b9zc1: