Lineage for d6b9za1 (6b9z A:1-106)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2355236Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2355237Protein automated matches [190740] (24 species)
    not a true protein
  7. 2355363Species Human (Homo sapiens) [TaxId:9606] [187920] (1083 PDB entries)
  8. 3057149Domain d6b9za1: 6b9z A:1-106 [357211]
    Other proteins in same PDB: d6b9za2, d6b9zc1, d6b9zc2, d6b9ze1, d6b9ze2
    automated match to d1dn0a1

Details for d6b9za1

PDB Entry: 6b9z (more details), 1.82 Å

PDB Description: trastuzumab fab v3
PDB Compounds: (A:) Trastuzumab Fab light chain

SCOPe Domain Sequences for d6b9za1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6b9za1 b.1.1.0 (A:1-106) automated matches {Human (Homo sapiens) [TaxId: 9606]}
diqmtqspillsasvgdrvtitcrasqdvntavawyqqrtngsprlliysasflysgvps
rfsgsrsgtdftltisslqpedeadyycqqhyttpptfgagtkvei

SCOPe Domain Coordinates for d6b9za1:

Click to download the PDB-style file with coordinates for d6b9za1.
(The format of our PDB-style files is described here.)

Timeline for d6b9za1:

  • d6b9za1 appears in periodic updates to SCOPe 2.07 starting on 2018-09-06