Lineage for d6b9ze1 (6b9z E:21-81)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2501110Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2503865Superfamily d.15.7: Immunoglobulin-binding domains [54358] (1 family) (S)
  5. 2503866Family d.15.7.1: Immunoglobulin-binding domains [54359] (3 proteins)
  6. 2503973Protein automated matches [190067] (6 species)
    not a true protein
  7. 2503979Species Finegoldia magna [TaxId:1260] [188811] (7 PDB entries)
  8. 3056928Domain d6b9ze1: 6b9z E:21-81 [356990]
    Other proteins in same PDB: d6b9za1, d6b9za2, d6b9zc1, d6b9zc2, d6b9ze2
    automated match to d1ymhe_

Details for d6b9ze1

PDB Entry: 6b9z (more details), 1.82 Å

PDB Description: trastuzumab fab v3
PDB Compounds: (E:) protein l

SCOPe Domain Sequences for d6b9ze1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6b9ze1 d.15.7.1 (E:21-81) automated matches {Finegoldia magna [TaxId: 1260]}
vtikvnlifadgkiqtaefkgtfeeataeayryaallakvngeytadledggnhmnikfa
g

SCOPe Domain Coordinates for d6b9ze1:

Click to download the PDB-style file with coordinates for d6b9ze1.
(The format of our PDB-style files is described here.)

Timeline for d6b9ze1:

  • d6b9ze1 appears in periodic updates to SCOPe 2.07 starting on 2018-09-06