Class a: All alpha proteins [46456] (290 folds) |
Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
Superfamily a.118.7: 14-3-3 protein [48445] (1 family) automatically mapped to Pfam PF00244 |
Family a.118.7.1: 14-3-3 protein [48446] (5 proteins) |
Protein automated matches [190238] (11 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [313882] (4 PDB entries) |
Domain d5wfua_: 5wfu A: [355015] automated match to d4dnkb_ complexed with mlt |
PDB Entry: 5wfu (more details), 1.97 Å
SCOPe Domain Sequences for d5wfua_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5wfua_ a.118.7.1 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} mtmdkselvqkaklaeqaeryddmaaamkavteqghelsneernllsvayknvvgarrss wrvissieqkternekkqqmgkeyrekieaelqdicndvlelldkylilnatqaeskvfy lkmkgdyfrylsevasgenkqttvsnsqqayqeafeiskkemqpthpirlglalnfsvfy yeilnspekacslaktafdeaiaeldtlneesykdstlimqllrdnltlwtsen
Timeline for d5wfua_: