Lineage for d5wfua_ (5wfu A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2725421Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2726458Superfamily a.118.7: 14-3-3 protein [48445] (1 family) (S)
    automatically mapped to Pfam PF00244
  5. 2726459Family a.118.7.1: 14-3-3 protein [48446] (5 proteins)
  6. 2726519Protein automated matches [190238] (11 species)
    not a true protein
  7. 2726628Species Mouse (Mus musculus) [TaxId:10090] [313882] (4 PDB entries)
  8. 2726631Domain d5wfua_: 5wfu A: [355015]
    automated match to d4dnkb_
    complexed with mlt

Details for d5wfua_

PDB Entry: 5wfu (more details), 1.97 Å

PDB Description: structural basis for the interaction of 14-3-3beta with tricarboxylic acid cycle intermediate malate
PDB Compounds: (A:) 14-3-3 protein beta/alpha

SCOPe Domain Sequences for d5wfua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5wfua_ a.118.7.1 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
mtmdkselvqkaklaeqaeryddmaaamkavteqghelsneernllsvayknvvgarrss
wrvissieqkternekkqqmgkeyrekieaelqdicndvlelldkylilnatqaeskvfy
lkmkgdyfrylsevasgenkqttvsnsqqayqeafeiskkemqpthpirlglalnfsvfy
yeilnspekacslaktafdeaiaeldtlneesykdstlimqllrdnltlwtsen

SCOPe Domain Coordinates for d5wfua_:

Click to download the PDB-style file with coordinates for d5wfua_.
(The format of our PDB-style files is described here.)

Timeline for d5wfua_: