PDB entry 5wfu

View 5wfu on RCSB PDB site
Description: Structural basis for the interaction of 14-3-3beta with Tricarboxylic Acid Cycle intermediate Malate
Class: protein binding
Keywords: 14-3-3 beta, Malate, Malic acid, PROTEIN BINDING
Deposited on 2017-07-12, released 2018-07-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-07-18, with a file datestamp of 2018-07-13.
Experiment type: XRAY
Resolution: 1.97 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 14-3-3 protein beta/alpha
    Species: Mus musculus [TaxId:10090]
    Gene: Ywhab
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5wfua_
  • Chain 'B':
    Compound: 14-3-3 protein beta/alpha
    Species: Mus musculus [TaxId:10090]
    Gene: Ywhab
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5wfub_
  • Chain 'C':
    Compound: 14-3-3 protein beta/alpha
    Species: Mus musculus [TaxId:10090]
    Gene: Ywhab
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5wfuc_
  • Chain 'D':
    Compound: 14-3-3 protein beta/alpha
    Species: Mus musculus [TaxId:10090]
    Gene: Ywhab
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5wfud_
  • Heterogens: MLT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5wfuA (A:)
    mtmdkselvqkaklaeqaeryddmaaamkavteqghelsneernllsvayknvvgarrss
    wrvissieqkternekkqqmgkeyrekieaelqdicndvlelldkylilnatqaeskvfy
    lkmkgdyfrylsevasgenkqttvsnsqqayqeafeiskkemqpthpirlglalnfsvfy
    yeilnspekacslaktafdeaiaeldtlneesykdstlimqllrdnltlwtsenqgdegd
    agegen
    

    Sequence, based on observed residues (ATOM records): (download)
    >5wfuA (A:)
    mtmdkselvqkaklaeqaeryddmaaamkavteqghelsneernllsvayknvvgarrss
    wrvissieqkternekkqqmgkeyrekieaelqdicndvlelldkylilnatqaeskvfy
    lkmkgdyfrylsevasgenkqttvsnsqqayqeafeiskkemqpthpirlglalnfsvfy
    yeilnspekacslaktafdeaiaeldtlneesykdstlimqllrdnltlwtsen
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5wfuB (B:)
    mtmdkselvqkaklaeqaeryddmaaamkavteqghelsneernllsvayknvvgarrss
    wrvissieqkternekkqqmgkeyrekieaelqdicndvlelldkylilnatqaeskvfy
    lkmkgdyfrylsevasgenkqttvsnsqqayqeafeiskkemqpthpirlglalnfsvfy
    yeilnspekacslaktafdeaiaeldtlneesykdstlimqllrdnltlwtsenqgdegd
    agegen
    

    Sequence, based on observed residues (ATOM records): (download)
    >5wfuB (B:)
    mtmdkselvqkaklaeqaeryddmaaamkavteqghelsneernllsvayknvvgarrss
    wrvissieqkternekkqqmgkeyrekieaelqdicndvlelldkylilnatqaeskvfy
    lkmkgdyfrylsevasgenkqttvsnsqqayqeafeiskkemqpthpirlglalnfsvfy
    yeilnspekacslaktafdeaiaeldtlneesykdstlimqllrdnltlwtse
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5wfuC (C:)
    mtmdkselvqkaklaeqaeryddmaaamkavteqghelsneernllsvayknvvgarrss
    wrvissieqkternekkqqmgkeyrekieaelqdicndvlelldkylilnatqaeskvfy
    lkmkgdyfrylsevasgenkqttvsnsqqayqeafeiskkemqpthpirlglalnfsvfy
    yeilnspekacslaktafdeaiaeldtlneesykdstlimqllrdnltlwtsenqgdegd
    agegen
    

    Sequence, based on observed residues (ATOM records): (download)
    >5wfuC (C:)
    mtmdkselvqkaklaeqaeryddmaaamkavteqghelsneernllsvayknvvgarrss
    wrvissieqkternekkqqmgkeyrekieaelqdicndvlelldkylilnatqaeskvfy
    lkmkgdyfrylsevasgenkqttvsnsqqayqeafeiskkemqpthpirlglalnfsvfy
    yeilnspekacslaktafdeaiaeldtlneesykdstlimqllrdnltlwtse
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5wfuD (D:)
    mtmdkselvqkaklaeqaeryddmaaamkavteqghelsneernllsvayknvvgarrss
    wrvissieqkternekkqqmgkeyrekieaelqdicndvlelldkylilnatqaeskvfy
    lkmkgdyfrylsevasgenkqttvsnsqqayqeafeiskkemqpthpirlglalnfsvfy
    yeilnspekacslaktafdeaiaeldtlneesykdstlimqllrdnltlwtsenqgdegd
    agegen
    

    Sequence, based on observed residues (ATOM records): (download)
    >5wfuD (D:)
    mtmdkselvqkaklaeqaeryddmaaamkavteqghelsneernllsvayknvvgarrss
    wrvissieqkternekkqqmgkeyrekieaelqdicndvlelldkylilnatqaeskvfy
    lkmkgdyfrylsevasgenkqttvsnsqqayqeafeiskkemqpthpirlglalnfsvfy
    yeilnspekacslaktafdeaiaeldtlneesykdstlimqllrdnltlwtsen