Lineage for d6cfds_ (6cfd S:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2852293Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2852294Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2852295Family c.14.1.1: Clp protease, ClpP subunit [52097] (2 proteins)
    automatically mapped to Pfam PF00574
  6. 2852608Protein automated matches [190149] (14 species)
    not a true protein
  7. 2852667Species Enterococcus faecium [TaxId:1352] [352041] (1 PDB entry)
  8. 2852680Domain d6cfds_: 6cfd S: [352048]
    automated match to d5g1sc_
    complexed with eza, mpd

Details for d6cfds_

PDB Entry: 6cfd (more details), 2.57 Å

PDB Description: adep4 bound to e. faecium clpp
PDB Compounds: (S:) ATP-dependent Clp protease proteolytic subunit

SCOPe Domain Sequences for d6cfds_:

Sequence, based on SEQRES records: (download)

>d6cfds_ c.14.1.1 (S:) automated matches {Enterococcus faecium [TaxId: 1352]}
iptvieqssrgeraydiysrllkdriimlsgqvtddlansiiaqllfldaqdsekdiyly
inspggsvtagmaiydtmnfvkadvqtivmgmaasmgsflltagtkgkrfalpnaeimih
qplggaqgqateieiaarhilqtrerlnkilaertgqpleviekdtdrdnymtaeqakay
glidevme

Sequence, based on observed residues (ATOM records): (download)

>d6cfds_ c.14.1.1 (S:) automated matches {Enterococcus faecium [TaxId: 1352]}
iptviaydiysrllkdriimlsgqvtddlansiiaqllfldaqdsekdiylyinspggsv
tagmaiydtmnfvkadvqtivmgmaasmgsflltagtkgkrfalpnaeimihqplggaqg
qateieiaarhilqtrerlnkilaertgqpleviekdtdrdnymtaeqakayglidevme

SCOPe Domain Coordinates for d6cfds_:

Click to download the PDB-style file with coordinates for d6cfds_.
(The format of our PDB-style files is described here.)

Timeline for d6cfds_: