PDB entry 6cfd

View 6cfd on RCSB PDB site
Description: ADEP4 bound to E. faecium ClpP
Class: hydrolase/antibiotic
Keywords: ClpP, ADEP4, HYDROLASE-ANTIBIOTIC complex
Deposited on 2018-02-14, released 2018-05-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-05-16, with a file datestamp of 2018-05-11.
Experiment type: XRAY
Resolution: 2.57 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ATP-dependent Clp protease proteolytic subunit
    Species: Enterococcus faecium [TaxId:1352]
    Gene: clpP, A5804_002055, A5809_001747, A5810_000386, A5814_002098, A5836_000160, A5841_002116, A5860_002409, AS238_05290, AWT83_05460, B1P95_10385, B4W81_08585, BK413_10305, BK695_10280, BK696_10275, BTA10_07855, BTA13_11970, BU181_02235, BU182_15300, BU184_14080, BU185_04695, BU186_06175, BU187_13865, BU188_14880, BU189_03420, BU190_07525, BU191_15420, BU192_05390, BU194_04805, CDL00_11615, CKY17_04320, CKY19_04880, CQR37_09710, CQR38_04150, CQR40_12365, CQR41_03640, CQR43_09890, CRM75_14685, CRN03_11890, CS913_12780, CS915_12510, CS916_12510, DTPHA_601708, EFM1CSP_03625, HMPREF3199_00581
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6cfda_
  • Chain 'B':
    Compound: ATP-dependent Clp protease proteolytic subunit
    Species: Enterococcus faecium [TaxId:1352]
    Gene: clpP, A5804_002055, A5809_001747, A5810_000386, A5814_002098, A5836_000160, A5841_002116, A5860_002409, AS238_05290, AWT83_05460, B1P95_10385, B4W81_08585, BK413_10305, BK695_10280, BK696_10275, BTA10_07855, BTA13_11970, BU181_02235, BU182_15300, BU184_14080, BU185_04695, BU186_06175, BU187_13865, BU188_14880, BU189_03420, BU190_07525, BU191_15420, BU192_05390, BU194_04805, CDL00_11615, CKY17_04320, CKY19_04880, CQR37_09710, CQR38_04150, CQR40_12365, CQR41_03640, CQR43_09890, CRM75_14685, CRN03_11890, CS913_12780, CS915_12510, CS916_12510, DTPHA_601708, EFM1CSP_03625, HMPREF3199_00581
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6cfdb_
  • Chain 'C':
    Compound: ATP-dependent Clp protease proteolytic subunit
    Species: Enterococcus faecium [TaxId:1352]
    Gene: clpP, A5804_002055, A5809_001747, A5810_000386, A5814_002098, A5836_000160, A5841_002116, A5860_002409, AS238_05290, AWT83_05460, B1P95_10385, B4W81_08585, BK413_10305, BK695_10280, BK696_10275, BTA10_07855, BTA13_11970, BU181_02235, BU182_15300, BU184_14080, BU185_04695, BU186_06175, BU187_13865, BU188_14880, BU189_03420, BU190_07525, BU191_15420, BU192_05390, BU194_04805, CDL00_11615, CKY17_04320, CKY19_04880, CQR37_09710, CQR38_04150, CQR40_12365, CQR41_03640, CQR43_09890, CRM75_14685, CRN03_11890, CS913_12780, CS915_12510, CS916_12510, DTPHA_601708, EFM1CSP_03625, HMPREF3199_00581
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6cfdc_
  • Chain 'D':
    Compound: ATP-dependent Clp protease proteolytic subunit
    Species: Enterococcus faecium [TaxId:1352]
    Gene: clpP, A5804_002055, A5809_001747, A5810_000386, A5814_002098, A5836_000160, A5841_002116, A5860_002409, AS238_05290, AWT83_05460, B1P95_10385, B4W81_08585, BK413_10305, BK695_10280, BK696_10275, BTA10_07855, BTA13_11970, BU181_02235, BU182_15300, BU184_14080, BU185_04695, BU186_06175, BU187_13865, BU188_14880, BU189_03420, BU190_07525, BU191_15420, BU192_05390, BU194_04805, CDL00_11615, CKY17_04320, CKY19_04880, CQR37_09710, CQR38_04150, CQR40_12365, CQR41_03640, CQR43_09890, CRM75_14685, CRN03_11890, CS913_12780, CS915_12510, CS916_12510, DTPHA_601708, EFM1CSP_03625, HMPREF3199_00581
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6cfdd_
  • Chain 'E':
    Compound: ATP-dependent Clp protease proteolytic subunit
    Species: Enterococcus faecium [TaxId:1352]
    Gene: clpP, A5804_002055, A5809_001747, A5810_000386, A5814_002098, A5836_000160, A5841_002116, A5860_002409, AS238_05290, AWT83_05460, B1P95_10385, B4W81_08585, BK413_10305, BK695_10280, BK696_10275, BTA10_07855, BTA13_11970, BU181_02235, BU182_15300, BU184_14080, BU185_04695, BU186_06175, BU187_13865, BU188_14880, BU189_03420, BU190_07525, BU191_15420, BU192_05390, BU194_04805, CDL00_11615, CKY17_04320, CKY19_04880, CQR37_09710, CQR38_04150, CQR40_12365, CQR41_03640, CQR43_09890, CRM75_14685, CRN03_11890, CS913_12780, CS915_12510, CS916_12510, DTPHA_601708, EFM1CSP_03625, HMPREF3199_00581
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6cfde_
  • Chain 'F':
    Compound: ATP-dependent Clp protease proteolytic subunit
    Species: Enterococcus faecium [TaxId:1352]
    Gene: clpP, A5804_002055, A5809_001747, A5810_000386, A5814_002098, A5836_000160, A5841_002116, A5860_002409, AS238_05290, AWT83_05460, B1P95_10385, B4W81_08585, BK413_10305, BK695_10280, BK696_10275, BTA10_07855, BTA13_11970, BU181_02235, BU182_15300, BU184_14080, BU185_04695, BU186_06175, BU187_13865, BU188_14880, BU189_03420, BU190_07525, BU191_15420, BU192_05390, BU194_04805, CDL00_11615, CKY17_04320, CKY19_04880, CQR37_09710, CQR38_04150, CQR40_12365, CQR41_03640, CQR43_09890, CRM75_14685, CRN03_11890, CS913_12780, CS915_12510, CS916_12510, DTPHA_601708, EFM1CSP_03625, HMPREF3199_00581
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6cfdf_
  • Chain 'G':
    Compound: ATP-dependent Clp protease proteolytic subunit
    Species: Enterococcus faecium [TaxId:1352]
    Gene: clpP, A5804_002055, A5809_001747, A5810_000386, A5814_002098, A5836_000160, A5841_002116, A5860_002409, AS238_05290, AWT83_05460, B1P95_10385, B4W81_08585, BK413_10305, BK695_10280, BK696_10275, BTA10_07855, BTA13_11970, BU181_02235, BU182_15300, BU184_14080, BU185_04695, BU186_06175, BU187_13865, BU188_14880, BU189_03420, BU190_07525, BU191_15420, BU192_05390, BU194_04805, CDL00_11615, CKY17_04320, CKY19_04880, CQR37_09710, CQR38_04150, CQR40_12365, CQR41_03640, CQR43_09890, CRM75_14685, CRN03_11890, CS913_12780, CS915_12510, CS916_12510, DTPHA_601708, EFM1CSP_03625, HMPREF3199_00581
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6cfdg_
  • Chain 'I':
    Compound: ATP-dependent Clp protease proteolytic subunit
    Species: Enterococcus faecium [TaxId:1352]
    Gene: clpP, A5804_002055, A5809_001747, A5810_000386, A5814_002098, A5836_000160, A5841_002116, A5860_002409, AS238_05290, AWT83_05460, B1P95_10385, B4W81_08585, BK413_10305, BK695_10280, BK696_10275, BTA10_07855, BTA13_11970, BU181_02235, BU182_15300, BU184_14080, BU185_04695, BU186_06175, BU187_13865, BU188_14880, BU189_03420, BU190_07525, BU191_15420, BU192_05390, BU194_04805, CDL00_11615, CKY17_04320, CKY19_04880, CQR37_09710, CQR38_04150, CQR40_12365, CQR41_03640, CQR43_09890, CRM75_14685, CRN03_11890, CS913_12780, CS915_12510, CS916_12510, DTPHA_601708, EFM1CSP_03625, HMPREF3199_00581
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6cfdi_
  • Chain 'K':
    Compound: ATP-dependent Clp protease proteolytic subunit
    Species: Enterococcus faecium [TaxId:1352]
    Gene: clpP, A5804_002055, A5809_001747, A5810_000386, A5814_002098, A5836_000160, A5841_002116, A5860_002409, AS238_05290, AWT83_05460, B1P95_10385, B4W81_08585, BK413_10305, BK695_10280, BK696_10275, BTA10_07855, BTA13_11970, BU181_02235, BU182_15300, BU184_14080, BU185_04695, BU186_06175, BU187_13865, BU188_14880, BU189_03420, BU190_07525, BU191_15420, BU192_05390, BU194_04805, CDL00_11615, CKY17_04320, CKY19_04880, CQR37_09710, CQR38_04150, CQR40_12365, CQR41_03640, CQR43_09890, CRM75_14685, CRN03_11890, CS913_12780, CS915_12510, CS916_12510, DTPHA_601708, EFM1CSP_03625, HMPREF3199_00581
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6cfdk_
  • Chain 'L':
    Compound: ATP-dependent Clp protease proteolytic subunit
    Species: Enterococcus faecium [TaxId:1352]
    Gene: clpP, A5804_002055, A5809_001747, A5810_000386, A5814_002098, A5836_000160, A5841_002116, A5860_002409, AS238_05290, AWT83_05460, B1P95_10385, B4W81_08585, BK413_10305, BK695_10280, BK696_10275, BTA10_07855, BTA13_11970, BU181_02235, BU182_15300, BU184_14080, BU185_04695, BU186_06175, BU187_13865, BU188_14880, BU189_03420, BU190_07525, BU191_15420, BU192_05390, BU194_04805, CDL00_11615, CKY17_04320, CKY19_04880, CQR37_09710, CQR38_04150, CQR40_12365, CQR41_03640, CQR43_09890, CRM75_14685, CRN03_11890, CS913_12780, CS915_12510, CS916_12510, DTPHA_601708, EFM1CSP_03625, HMPREF3199_00581
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6cfdl_
  • Chain 'M':
    Compound: ATP-dependent Clp protease proteolytic subunit
    Species: Enterococcus faecium [TaxId:1352]
    Gene: clpP, A5804_002055, A5809_001747, A5810_000386, A5814_002098, A5836_000160, A5841_002116, A5860_002409, AS238_05290, AWT83_05460, B1P95_10385, B4W81_08585, BK413_10305, BK695_10280, BK696_10275, BTA10_07855, BTA13_11970, BU181_02235, BU182_15300, BU184_14080, BU185_04695, BU186_06175, BU187_13865, BU188_14880, BU189_03420, BU190_07525, BU191_15420, BU192_05390, BU194_04805, CDL00_11615, CKY17_04320, CKY19_04880, CQR37_09710, CQR38_04150, CQR40_12365, CQR41_03640, CQR43_09890, CRM75_14685, CRN03_11890, CS913_12780, CS915_12510, CS916_12510, DTPHA_601708, EFM1CSP_03625, HMPREF3199_00581
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6cfdm_
  • Chain 'N':
    Compound: ATP-dependent Clp protease proteolytic subunit
    Species: Enterococcus faecium [TaxId:1352]
    Gene: clpP, A5804_002055, A5809_001747, A5810_000386, A5814_002098, A5836_000160, A5841_002116, A5860_002409, AS238_05290, AWT83_05460, B1P95_10385, B4W81_08585, BK413_10305, BK695_10280, BK696_10275, BTA10_07855, BTA13_11970, BU181_02235, BU182_15300, BU184_14080, BU185_04695, BU186_06175, BU187_13865, BU188_14880, BU189_03420, BU190_07525, BU191_15420, BU192_05390, BU194_04805, CDL00_11615, CKY17_04320, CKY19_04880, CQR37_09710, CQR38_04150, CQR40_12365, CQR41_03640, CQR43_09890, CRM75_14685, CRN03_11890, CS913_12780, CS915_12510, CS916_12510, DTPHA_601708, EFM1CSP_03625, HMPREF3199_00581
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6cfdn_
  • Chain 'S':
    Compound: ATP-dependent Clp protease proteolytic subunit
    Species: Enterococcus faecium [TaxId:1352]
    Gene: clpP, A5804_002055, A5809_001747, A5810_000386, A5814_002098, A5836_000160, A5841_002116, A5860_002409, AS238_05290, AWT83_05460, B1P95_10385, B4W81_08585, BK413_10305, BK695_10280, BK696_10275, BTA10_07855, BTA13_11970, BU181_02235, BU182_15300, BU184_14080, BU185_04695, BU186_06175, BU187_13865, BU188_14880, BU189_03420, BU190_07525, BU191_15420, BU192_05390, BU194_04805, CDL00_11615, CKY17_04320, CKY19_04880, CQR37_09710, CQR38_04150, CQR40_12365, CQR41_03640, CQR43_09890, CRM75_14685, CRN03_11890, CS913_12780, CS915_12510, CS916_12510, DTPHA_601708, EFM1CSP_03625, HMPREF3199_00581
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6cfds_
  • Chain 'T':
    Compound: ATP-dependent Clp protease proteolytic subunit
    Species: Enterococcus faecium [TaxId:1352]
    Gene: clpP, A5804_002055, A5809_001747, A5810_000386, A5814_002098, A5836_000160, A5841_002116, A5860_002409, AS238_05290, AWT83_05460, B1P95_10385, B4W81_08585, BK413_10305, BK695_10280, BK696_10275, BTA10_07855, BTA13_11970, BU181_02235, BU182_15300, BU184_14080, BU185_04695, BU186_06175, BU187_13865, BU188_14880, BU189_03420, BU190_07525, BU191_15420, BU192_05390, BU194_04805, CDL00_11615, CKY17_04320, CKY19_04880, CQR37_09710, CQR38_04150, CQR40_12365, CQR41_03640, CQR43_09890, CRM75_14685, CRN03_11890, CS913_12780, CS915_12510, CS916_12510, DTPHA_601708, EFM1CSP_03625, HMPREF3199_00581
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6cfdt_
  • Heterogens: EZA, MPD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6cfdA (A:)
    mnliptvieqssrgeraydiysrllkdriimlsgqvtddlansiiaqllfldaqdsekdi
    ylyinspggsvtagmaiydtmnfvkadvqtivmgmaasmgsflltagtkgkrfalpnaei
    mihqplggaqgqateieiaarhilqtrerlnkilaertgqpleviekdtdrdnymtaeqa
    kayglidevmenssslkiegrglehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cfdA (A:)
    iptviraydiysrllkdriimlsgqvtddlansiiaqllfldaqdsekdiylyinspggs
    vtagmaiydtmnfvkadvqtivmgmaasmgsflltagtkgkrfalpnaeimihqplggaq
    gqateieiaarhilqtrerlnkilaertgqpleviekdtdrdnymtaeqakayglidevm
    e
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6cfdB (B:)
    mnliptvieqssrgeraydiysrllkdriimlsgqvtddlansiiaqllfldaqdsekdi
    ylyinspggsvtagmaiydtmnfvkadvqtivmgmaasmgsflltagtkgkrfalpnaei
    mihqplggaqgqateieiaarhilqtrerlnkilaertgqpleviekdtdrdnymtaeqa
    kayglidevmenssslkiegrglehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cfdB (B:)
    iptvieraydiysrllkdriimlsgqvtddlansiiaqllfldaqdsekdiylyinspgg
    svtagmaiydtmnfvkadvqtivmgmaasmgsflltagtkgkrfalpnaeimihqplgga
    qgqateieiaarhilqtrerlnkilaertgqpleviekdtdrdnymtaeqakayglidev
    me
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6cfdC (C:)
    mnliptvieqssrgeraydiysrllkdriimlsgqvtddlansiiaqllfldaqdsekdi
    ylyinspggsvtagmaiydtmnfvkadvqtivmgmaasmgsflltagtkgkrfalpnaei
    mihqplggaqgqateieiaarhilqtrerlnkilaertgqpleviekdtdrdnymtaeqa
    kayglidevmenssslkiegrglehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cfdC (C:)
    liptviydiysrllkdriimlsgqvtddlansiiaqllfldaqdsekdiylyinspggsv
    tagmaiydtmnfvkadvqtivmgmaasmgsflltagtkgkrfalpnaeimihqplggaqg
    qateieiaarhilqtrerlnkilaertgqpleviekdtdrdnymtaeqakayglidevme
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6cfdD (D:)
    mnliptvieqssrgeraydiysrllkdriimlsgqvtddlansiiaqllfldaqdsekdi
    ylyinspggsvtagmaiydtmnfvkadvqtivmgmaasmgsflltagtkgkrfalpnaei
    mihqplggaqgqateieiaarhilqtrerlnkilaertgqpleviekdtdrdnymtaeqa
    kayglidevmenssslkiegrglehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cfdD (D:)
    iptviraydiysrllkdriimlsgqvtddlansiiaqllfldaqdsekdiylyinspggs
    vtagmaiydtmnfvkadvqtivmgmaasmgsflltagtkgkrfalpnaeimihqplggaq
    gqateieiaarhilqtrerlnkilaertgqpleviekdtdrdnymtaeqakayglidevm
    e
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >6cfdE (E:)
    mnliptvieqssrgeraydiysrllkdriimlsgqvtddlansiiaqllfldaqdsekdi
    ylyinspggsvtagmaiydtmnfvkadvqtivmgmaasmgsflltagtkgkrfalpnaei
    mihqplggaqgqateieiaarhilqtrerlnkilaertgqpleviekdtdrdnymtaeqa
    kayglidevmenssslkiegrglehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cfdE (E:)
    liptvieeraydiysrllkdriimlsgqvtddlansiiaqllfldaqdsekdiylyinsp
    ggsvtagmaiydtmnfvkadvqtivmgmaasmgsflltagtkgkrfalpnaeimihqplg
    gaqgqateieiaarhilqtrerlnkilaertgqpleviekdtdrdnymtaeqakayglid
    evme
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >6cfdF (F:)
    mnliptvieqssrgeraydiysrllkdriimlsgqvtddlansiiaqllfldaqdsekdi
    ylyinspggsvtagmaiydtmnfvkadvqtivmgmaasmgsflltagtkgkrfalpnaei
    mihqplggaqgqateieiaarhilqtrerlnkilaertgqpleviekdtdrdnymtaeqa
    kayglidevmenssslkiegrglehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cfdF (F:)
    iptvieeraydiysrllkdriimlsgqvtddlansiiaqllfldaqdsekdiylyinspg
    gsvtagmaiydtmnfvkadvqtivmgmaasmgsflltagtkgkrfalpnaeimihqplgg
    aqgqateieiaarhilqtrerlnkilaertgqpleviekdtdrdnymtaeqakayglide
    vme
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >6cfdG (G:)
    mnliptvieqssrgeraydiysrllkdriimlsgqvtddlansiiaqllfldaqdsekdi
    ylyinspggsvtagmaiydtmnfvkadvqtivmgmaasmgsflltagtkgkrfalpnaei
    mihqplggaqgqateieiaarhilqtrerlnkilaertgqpleviekdtdrdnymtaeqa
    kayglidevmenssslkiegrglehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cfdG (G:)
    liptviraydiysrllkdriimlsgqvtddlansiiaqllfldaqdsekdiylyinspgg
    svtagmaiydtmnfvkadvqtivmgmaasmgsflltagtkgkrfalpnaeimihqplgga
    qgqateieiaarhilqtrerlnkilaertgqpleviekdtdrdnymtaeqakayglidev
    me
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >6cfdI (I:)
    mnliptvieqssrgeraydiysrllkdriimlsgqvtddlansiiaqllfldaqdsekdi
    ylyinspggsvtagmaiydtmnfvkadvqtivmgmaasmgsflltagtkgkrfalpnaei
    mihqplggaqgqateieiaarhilqtrerlnkilaertgqpleviekdtdrdnymtaeqa
    kayglidevmenssslkiegrglehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cfdI (I:)
    liptvieqssrgraydiysrllkdriimlsgqvtddlansiiaqllfldaqdsekdiyly
    inspggsvtagmaiydtmnfvkadvqtivmgmaasmgsflltagtkgkrfalpnaeimih
    qplggaqgqateieiaarhilqtrerlnkilaertgqpleviekdtdrdnymtaeqakay
    glidevme
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >6cfdK (K:)
    mnliptvieqssrgeraydiysrllkdriimlsgqvtddlansiiaqllfldaqdsekdi
    ylyinspggsvtagmaiydtmnfvkadvqtivmgmaasmgsflltagtkgkrfalpnaei
    mihqplggaqgqateieiaarhilqtrerlnkilaertgqpleviekdtdrdnymtaeqa
    kayglidevmenssslkiegrglehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cfdK (K:)
    liptvieeraydiysrllkdriimlsgqvtddlansiiaqllfldaqdsekdiylyinsp
    ggsvtagmaiydtmnfvkadvqtivmgmaasmgsflltagtkgkrfalpnaeimihqplg
    gaqgqateieiaarhilqtrerlnkilaertgqpleviekdtdrdnymtaeqakayglid
    evm
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >6cfdL (L:)
    mnliptvieqssrgeraydiysrllkdriimlsgqvtddlansiiaqllfldaqdsekdi
    ylyinspggsvtagmaiydtmnfvkadvqtivmgmaasmgsflltagtkgkrfalpnaei
    mihqplggaqgqateieiaarhilqtrerlnkilaertgqpleviekdtdrdnymtaeqa
    kayglidevmenssslkiegrglehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cfdL (L:)
    iptviaydiysrllkdriimlsgqvtddlansiiaqllfldaqdsekdiylyinspggsv
    tagmaiydtmnfvkadvqtivmgmaasmgsflltagtkgkrfalpnaeimihqplggaqg
    qateieiaarhilqtrerlnkilaertgqpleviekdtdrdnymtaeqakayglidevme
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >6cfdM (M:)
    mnliptvieqssrgeraydiysrllkdriimlsgqvtddlansiiaqllfldaqdsekdi
    ylyinspggsvtagmaiydtmnfvkadvqtivmgmaasmgsflltagtkgkrfalpnaei
    mihqplggaqgqateieiaarhilqtrerlnkilaertgqpleviekdtdrdnymtaeqa
    kayglidevmenssslkiegrglehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cfdM (M:)
    iptviraydiysrllkdriimlsgqvtddlansiiaqllfldaqdsekdiylyinspggs
    vtagmaiydtmnfvkadvqtivmgmaasmgsflltagtkgkrfalpnaeimihqplggaq
    gqateieiaarhilqtrerlnkilaertgqpleviekdtdrdnymtaeqakayglidevm
    e
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >6cfdN (N:)
    mnliptvieqssrgeraydiysrllkdriimlsgqvtddlansiiaqllfldaqdsekdi
    ylyinspggsvtagmaiydtmnfvkadvqtivmgmaasmgsflltagtkgkrfalpnaei
    mihqplggaqgqateieiaarhilqtrerlnkilaertgqpleviekdtdrdnymtaeqa
    kayglidevmenssslkiegrglehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cfdN (N:)
    iptvieraydiysrllkdriimlsgqvtddlansiiaqllfldaqdsekdiylyinspgg
    svtagmaiydtmnfvkadvqtivmgmaasmgsflltagtkgkrfalpnaeimihqplgga
    qgqateieiaarhilqtrerlnkilaertgqpleviekdtdrdnymtaeqakayglidev
    me
    

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >6cfdS (S:)
    mnliptvieqssrgeraydiysrllkdriimlsgqvtddlansiiaqllfldaqdsekdi
    ylyinspggsvtagmaiydtmnfvkadvqtivmgmaasmgsflltagtkgkrfalpnaei
    mihqplggaqgqateieiaarhilqtrerlnkilaertgqpleviekdtdrdnymtaeqa
    kayglidevmenssslkiegrglehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cfdS (S:)
    iptviaydiysrllkdriimlsgqvtddlansiiaqllfldaqdsekdiylyinspggsv
    tagmaiydtmnfvkadvqtivmgmaasmgsflltagtkgkrfalpnaeimihqplggaqg
    qateieiaarhilqtrerlnkilaertgqpleviekdtdrdnymtaeqakayglidevme
    

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >6cfdT (T:)
    mnliptvieqssrgeraydiysrllkdriimlsgqvtddlansiiaqllfldaqdsekdi
    ylyinspggsvtagmaiydtmnfvkadvqtivmgmaasmgsflltagtkgkrfalpnaei
    mihqplggaqgqateieiaarhilqtrerlnkilaertgqpleviekdtdrdnymtaeqa
    kayglidevmenssslkiegrglehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cfdT (T:)
    liptviaydiysrllkdriimlsgqvtddlansiiaqllfldaqdsekdiylyinspggs
    vtagmaiydtmnfvkadvqtivmgmaasmgsflltagtkgkrfalpnaeimihqplggaq
    gqateieiaarhilqtrerlnkilaertgqpleviekdtdrdnymtaeqakayglidevm
    e