Lineage for d6cfdn_ (6cfd N:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2435650Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2435651Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2435652Family c.14.1.1: Clp protease, ClpP subunit [52097] (2 protein domains)
    automatically mapped to Pfam PF00574
  6. 2435832Protein automated matches [190149] (10 species)
    not a true protein
  7. 3051979Species Enterococcus faecium [TaxId:1352] [352041] (1 PDB entry)
  8. 3052271Domain d6cfdn_: 6cfd N: [352333]
    automated match to d5g1sc_
    complexed with eza, mpd

Details for d6cfdn_

PDB Entry: 6cfd (more details), 2.57 Å

PDB Description: adep4 bound to e. faecium clpp
PDB Compounds: (N:) ATP-dependent Clp protease proteolytic subunit

SCOPe Domain Sequences for d6cfdn_:

Sequence, based on SEQRES records: (download)

>d6cfdn_ c.14.1.1 (N:) automated matches {Enterococcus faecium [TaxId: 1352]}
iptvieqssrgeraydiysrllkdriimlsgqvtddlansiiaqllfldaqdsekdiyly
inspggsvtagmaiydtmnfvkadvqtivmgmaasmgsflltagtkgkrfalpnaeimih
qplggaqgqateieiaarhilqtrerlnkilaertgqpleviekdtdrdnymtaeqakay
glidevme

Sequence, based on observed residues (ATOM records): (download)

>d6cfdn_ c.14.1.1 (N:) automated matches {Enterococcus faecium [TaxId: 1352]}
iptvieraydiysrllkdriimlsgqvtddlansiiaqllfldaqdsekdiylyinspgg
svtagmaiydtmnfvkadvqtivmgmaasmgsflltagtkgkrfalpnaeimihqplgga
qgqateieiaarhilqtrerlnkilaertgqpleviekdtdrdnymtaeqakayglidev
me

SCOPe Domain Coordinates for d6cfdn_:

Click to download the PDB-style file with coordinates for d6cfdn_.
(The format of our PDB-style files is described here.)

Timeline for d6cfdn_:

  • d6cfdn_ appears in periodic updates to SCOPe 2.07 starting on 2018-05-17