Class a: All alpha proteins [46456] (290 folds) |
Fold a.29: Bromodomain-like [47363] (15 superfamilies) 4 helices; bundle; minor mirror variant of up-and-down topology |
Superfamily a.29.2: Bromodomain [47370] (2 families) |
Family a.29.2.1: Bromodomain [47371] (6 proteins) |
Protein TAFII250 double bromodomain module [47377] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [47378] (2 PDB entries) |
Domain d6fict2: 6fic T:1498-1621 [350620] automated match to d1eqfa2 complexed with dkh |
PDB Entry: 6fic (more details), 2.18 Å
SCOPe Domain Sequences for d6fict2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6fict2 a.29.2.1 (T:1498-1621) TAFII250 double bromodomain module {Human (Homo sapiens) [TaxId: 9606]} llddddqvafsfildnivtqkmmavpdswpfhhpvnkkfvpdyykvivnpmdletirkni skhkyqsresflddvnlilansvkyngpesqytktaqeivnvcyqtlteydehltqlekd icta
Timeline for d6fict2: