Lineage for d6fict2 (6fic T:1498-1621)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2316812Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 2316813Superfamily a.29.2: Bromodomain [47370] (2 families) (S)
  5. 2316814Family a.29.2.1: Bromodomain [47371] (6 protein domains)
  6. 2316887Protein TAFII250 double bromodomain module [47377] (1 species)
  7. 2316888Species Human (Homo sapiens) [TaxId:9606] [47378] (2 PDB entries)
  8. 3050558Domain d6fict2: 6fic T:1498-1621 [350620]
    automated match to d1eqfa2
    complexed with dkh

Details for d6fict2

PDB Entry: 6fic (more details), 2.18 Å

PDB Description: bivalent inhibitor unc4512 bound to the taf1 bromodomain tandem
PDB Compounds: (T:) Transcription initiation factor TFIID subunit 1

SCOPe Domain Sequences for d6fict2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6fict2 a.29.2.1 (T:1498-1621) TAFII250 double bromodomain module {Human (Homo sapiens) [TaxId: 9606]}
llddddqvafsfildnivtqkmmavpdswpfhhpvnkkfvpdyykvivnpmdletirkni
skhkyqsresflddvnlilansvkyngpesqytktaqeivnvcyqtlteydehltqlekd
icta

SCOPe Domain Coordinates for d6fict2:

Click to download the PDB-style file with coordinates for d6fict2.
(The format of our PDB-style files is described here.)

Timeline for d6fict2:

  • d6fict2 appears in periodic updates to SCOPe 2.07 starting on 2018-04-08

View in 3D
Domains from same chain:
(mouse over for more information)
d6fict1