Lineage for d6fict1 (6fic T:1377-1497)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2706693Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 2706694Superfamily a.29.2: Bromodomain [47370] (2 families) (S)
  5. 2706695Family a.29.2.1: Bromodomain [47371] (6 proteins)
  6. 2706810Protein TAFII250 double bromodomain module [47377] (1 species)
  7. 2706811Species Human (Homo sapiens) [TaxId:9606] [47378] (2 PDB entries)
  8. 2706814Domain d6fict1: 6fic T:1377-1497 [350619]
    automated match to d1eqfa1
    complexed with dkh

Details for d6fict1

PDB Entry: 6fic (more details), 2.18 Å

PDB Description: bivalent inhibitor unc4512 bound to the taf1 bromodomain tandem
PDB Compounds: (T:) Transcription initiation factor TFIID subunit 1

SCOPe Domain Sequences for d6fict1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6fict1 a.29.2.1 (T:1377-1497) TAFII250 double bromodomain module {Human (Homo sapiens) [TaxId: 9606]}
rrtdpmvtlssilesiindmrdlpntypfhtpvnakvvkdyykiitrpmdlqtlrenvrk
rlypsreefrehlelivknsatyngpkhsltqisqsmldlcdeklkekedklarlekain
p

SCOPe Domain Coordinates for d6fict1:

Click to download the PDB-style file with coordinates for d6fict1.
(The format of our PDB-style files is described here.)

Timeline for d6fict1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6fict2