Lineage for d6f2la_ (6f2l A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2335122Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2335123Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2335124Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 protein domains)
  6. 2335636Protein Peroxisome proliferator activated receptor gamma, PPAR-gamma [48524] (1 species)
  7. 2335637Species Human (Homo sapiens) [TaxId:9606] [48525] (119 PDB entries)
    Uniprot P37231 232-505
  8. 3050478Domain d6f2la_: 6f2l A: [350540]
    automated match to d1nyxa_
    complexed with axy

Details for d6f2la_

PDB Entry: 6f2l (more details), 2.1 Å

PDB Description: crystal structure of the complex between ppargamma lbd and the ligand lj570: structure obtained from crystals of the apo-form soaked for 15 days.
PDB Compounds: (A:) Peroxisome proliferator-activated receptor gamma

SCOPe Domain Sequences for d6f2la_:

Sequence, based on SEQRES records: (download)

>d6f2la_ a.123.1.1 (A:) Peroxisome proliferator activated receptor gamma, PPAR-gamma {Human (Homo sapiens) [TaxId: 9606]}
esadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmgedkikfkh
itplqeqskevairifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvheii
ytmlaslmnkdgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdlai
fiaviilsgdrpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqiv
tehvqllqvikktetdmslhpllqeiyk

Sequence, based on observed residues (ATOM records): (download)

>d6f2la_ a.123.1.1 (A:) Peroxisome proliferator activated receptor gamma, PPAR-gamma {Human (Homo sapiens) [TaxId: 9606]}
esadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmgedkikfkk
evairifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvheiiytmlaslmn
kdgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdlaifiaviilsg
drpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqivtehvqllqv
ikktetdmslhpllqeiyk

SCOPe Domain Coordinates for d6f2la_:

Click to download the PDB-style file with coordinates for d6f2la_.
(The format of our PDB-style files is described here.)

Timeline for d6f2la_:

  • d6f2la_ appears in periodic updates to SCOPe 2.07 starting on 2018-04-08